PPP1R1B (protein phosphatase 1 regulatory inhibitor subunit 1B)

Gene

• Entrez ID: 84152
• Gene name: Protein phosphatase 1 regulatory inhibitor subunit 1B
• Gene symbol: PPP1R1B
• Synonyms: DARPP-32, DARPP32
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT733522	hsa-miR-7844-5p	Luciferase reporter assay, RNA-seq, qRT-PCR	33189894
MIRT1256355	hsa-miR-1275	CLIP-seq
MIRT1256356	hsa-miR-4525	CLIP-seq
MIRT1256357	hsa-miR-4665-5p	CLIP-seq
MIRT1256358	hsa-miR-4723-5p	CLIP-seq
MIRT1256359	hsa-miR-490-3p	CLIP-seq
MIRT1256360	hsa-miR-566	CLIP-seq
MIRT1256361	hsa-miR-625	CLIP-seq
MIRT1256362	hsa-miR-637	CLIP-seq
MIRT1256363	hsa-miR-1343	CLIP-seq
MIRT1256364	hsa-miR-330-3p	CLIP-seq
MIRT1256365	hsa-miR-4642	CLIP-seq
MIRT1256366	hsa-miR-4720-5p	CLIP-seq
MIRT1256367	hsa-miR-4799-3p	CLIP-seq
MIRT2302161	hsa-miR-1182	CLIP-seq
MIRT2302162	hsa-miR-146b-3p	CLIP-seq
MIRT2302163	hsa-miR-193a-5p	CLIP-seq
MIRT2302164	hsa-miR-3173-5p	CLIP-seq
MIRT2302165	hsa-miR-3945	CLIP-seq
MIRT2302166	hsa-miR-4253	CLIP-seq
MIRT2302167	hsa-miR-4269	CLIP-seq
MIRT2302168	hsa-miR-4514	CLIP-seq
MIRT2302169	hsa-miR-4692	CLIP-seq
MIRT2302170	hsa-miR-4711-5p	CLIP-seq
MIRT2302171	hsa-miR-4722-3p	CLIP-seq
MIRT2302172	hsa-miR-4742-5p	CLIP-seq
MIRT2302173	hsa-miR-541	CLIP-seq
MIRT2302174	hsa-miR-654-5p	CLIP-seq
MIRT2302175	hsa-miR-874	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001975	Process	Response to amphetamine	IEA
GO:0004860	Function	Protein kinase inhibitor activity	TAS	10604473
GO:0004864	Function	Protein phosphatase inhibitor activity	IDA	10807923
GO:0004864	Function	Protein phosphatase inhibitor activity	TAS	10604473
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006351	Process	Transcription, DNA-templated	IEA
GO:0006469	Process	Negative regulation of protein kinase activity	IEA
GO:0007165	Process	Signal transduction	TAS	10604473
GO:0007613	Process	Memory	IEA
GO:0007621	Process	Negative regulation of female receptivity	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008542	Process	Visual learning	IEA
GO:0019888	Function	Protein phosphatase regulator activity	TAS
GO:0031748	Function	D1 dopamine receptor binding	IEA
GO:0031749	Function	D2 dopamine receptor binding	IEA
GO:0031750	Function	D3 dopamine receptor binding	IEA
GO:0031751	Function	D4 dopamine receptor binding	IEA
GO:0031752	Function	D5 dopamine receptor binding	IEA
GO:0032515	Process	Negative regulation of phosphoprotein phosphatase activity	IDA	10807923
GO:0035094	Process	Response to nicotine	IEA
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0043025	Component	Neuronal cell body	IEA
GO:0043278	Process	Response to morphine	IEA
GO:0044326	Component	Dendritic spine neck	IEA
GO:0044327	Component	Dendritic spine head	IEA
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

Other IDs

• MIM: 604399
• HGNC: 9287
• e!Ensembl: ENSG00000131771

Protein

• UniProt ID: Q9UD71
• Protein name: Protein phosphatase 1 regulatory subunit 1B (DARPP-32) (Dopamine- and cAMP-regulated neuronal phosphoprotein)
• Protein function: Inhibitor of protein-phosphatase 1.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05395	DARPP-32	2 → 181	Protein phosphatase inhibitor 1/DARPP-32	Family

• Sequence:

  MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGE
  GHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREE
  DEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSED
  QVEDPALSEPGEEPQRPSPSEPGT

• Sequence length: 204

Pathways

KEGG:

cAMP signaling pathway
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism

Reactome:

DARPP-32 events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	21453742, 23295814, 24704945, 22179181, 20874815

Unknown
Disease name	Disease term	dbSNP ID	References
Ballismus	Ballismus		20682746
Bipolar disorder	Bipolar Disorder		23295814, 20874815, 18055181, 18573638
Catalepsy	Catalepsy		20682746
Dyskinetic syndrome	Dyskinetic syndrome		20682746
Hemiballismus	Hemiballismus		20682746
Orofacial dyskinesia	Lingual-Facial-Buccal Dyskinesia		20682746
Mental depression	Mental Depression, Depressive disorder	rs587778876, rs587778877	19834457
Oral dyskinesia	Oral Dyskinesia		20682746