GediPNet logo

DTNBP1 (dystrobrevin binding protein 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84062
Gene nameGene Name - the full gene name approved by the HGNC.
Dystrobrevin binding protein 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
DTNBP1
SynonymsGene synonyms aliases
BLOC1S8, DBND, HPS7, My031, SDY
ChromosomeChromosome number
6
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.3
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles c
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104893945 G>A Pathogenic Genic upstream transcript variant, coding sequence variant, stop gained, non coding transcript variant
rs727502866 C>T Pathogenic 5 prime UTR variant, coding sequence variant, non coding transcript variant, genic upstream transcript variant, stop gained
rs752074481 CTCT>-,CT Pathogenic, uncertain-significance Frameshift variant, coding sequence variant, genic downstream transcript variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT946763 hsa-miR-1229 CLIP-seq
MIRT946764 hsa-miR-342-3p CLIP-seq
MIRT946765 hsa-miR-377 CLIP-seq
MIRT946766 hsa-miR-1207-5p CLIP-seq
MIRT946767 hsa-miR-135a CLIP-seq
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001956 Process Positive regulation of neurotransmitter secretion ISS
GO:0005515 Function Protein binding IPI 15102850, 19349376, 20921223, 22203680, 23414517, 25416956, 32296183
GO:0005634 Component Nucleus ISS
GO:0005737 Component Cytoplasm ISS
GO:0005789 Component Endoplasmic reticulum membrane ISS
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q96EV8
Protein name Dysbindin (Biogenesis of lysosome-related organelles complex 1 subunit 8) (BLOC-1 subunit 8) (Dysbindin-1) (Dystrobrevin-binding protein 1) (Hermansky-Pudlak syndrome 7 protein) (HPS7 protein)
Protein function Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target m
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04440 Dysbindin
175 320
Dysbindin (Dystrobrevin binding protein 1)
Family
Sequence
MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWA
ALHRRAKDCASAGELVDSEVVMLSAHWEKKKTSLVELQEQLQQLPALIADLESMTANLTH
LEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKKNKRKELETFKAELDAEHAQK
VLEMEHTQQMKLKERQKFFEEAFQQDMEQYLSTGYLQIAERREPIGSMSSMEVNVDMLEQ
MDLMDISDQEALDVFLNSGGEENTVLSPALGPESSTCQNEITLQVPNPSELRAKPPSSSS
TCTDSATRDISEGGESPVVQ
SDEEEVQVDTALATSHTDREATPDGGEDSDS
Sequence length 351
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    Golgi Associated Vesicle Biogenesis
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Albinism Albinism rs28940876, rs387906560, rs62635045, rs140365820, rs141949212, rs1384042381, rs62635042
Carcinoma Squamous cell carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 31174203
Hermansky-pudlak syndrome Hermanski-Pudlak Syndrome, HERMANSKY-PUDLAK SYNDROME 7, Hermansky-Pudlak syndrome type 7 rs281865116, rs281865113, rs281865103, rs104893945, rs119471021, rs281865100, rs281865097, rs119471022, rs119471023, rs119471024, rs119471025, rs201227603, rs281865093, rs397507168, rs281865095, rs121908316, rs281865163, rs281865082, rs121908385, rs121908386, rs281865081, rs281865077, rs121908904, rs1000881595, rs121908905, rs121908906, rs121908907, rs281865084, rs281865086, rs281865088, rs281865090, rs281865075, rs281865076, rs281865080, rs281865104, rs281865105, rs397507169, rs281865101, rs201348482, rs1564899492, rs281865114, rs281865110, rs281865107, rs281865112, rs727502866, rs786205464, rs869312835, rs869312836, rs869312837, rs869312838, rs369053765, rs879255646, rs886041723, rs1591055649, rs753928208, rs113304476, rs1131692151, rs1131692149, rs1131692146, rs1131692148, rs1131692147, rs764296457, rs1131692150, rs1131692332, rs1131692333, rs766602179, rs281865115, rs1554903728, rs1220869113, rs773323079, rs1554948134, rs1486224265, rs1277509410, rs1553750083, rs372020804, rs1564899012, rs1590262288, rs753185316, rs1553750097, rs780183200, rs1576695913, rs1576708708, rs1590262450, rs756471925, rs1478574193, rs1590263807, rs1590263820, rs779921624, rs755827664, rs374689398, rs886077189, rs1591120765, rs1260083432, rs748883997, rs750685598, rs778152054, rs755083879, rs1488175163, rs1591092841, rs1576687466, rs756325364, rs1591002808, rs1591045080, rs1602079277, rs1591109881, rs1591031929, rs200079039, rs1595560288, rs772475341, rs1330496818, rs1745947620, rs552340796, rs1453977337, rs754841982, rs1568469902, rs1763106978 31064749, 28259707, 12923531
Nystagmus Nystagmus rs137852207, rs137852208, rs1928435502, rs137852209, rs137852210, rs1929191668, rs137852211, rs137852212, rs2124209414, rs387906720, rs387906721, rs1602791884, rs786205896
Unknown
Disease name Disease term dbSNP ID References
Albinism with hemorrhagic diathesis and pigmented reticuloendothelial cells Albinism with hemorrhagic diathesis and pigmented reticuloendothelial cells
Behavior disorders Behavior Disorders rs28914832, rs748194758, rs7224199, rs3813034, rs886052778, rs199601052, rs200528841, rs138004662, rs140699, rs886052781, rs6354, rs886052782, rs199876421, rs56138846, rs200506079, rs886052774, rs185569563, rs886052777, rs181130006, rs200363238, rs567262768, rs201053633, rs200633071, rs56110451, rs114814153, rs28914831, rs45541837, rs25533, rs886052784, rs201844395, rs746067804, rs56140935, rs185658988, rs886052775, rs886052776, rs55823902, rs1042173, rs886052779, rs6352, rs6353, rs200861334, rs55908624, rs886052780, rs201073368, rs34845320, rs199890541, rs763069645, rs202111661, rs886052783, rs74845752, rs41274284 25298178
Bipolar disorder Bipolar Disorder 18234478, 19573260, 19089808, 18180429, 21305691
Mental disorders Mental disorders, Mental Disorders, Severe 25298178

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412