CASP4 (caspase 4)

Gene

• Entrez ID: 837
• Gene name: Caspase 4
• Gene symbol: CASP4
• Synonyms: ICE(rel)II, ICEREL-II, ICH-2, Mih1, Mih1/TX, TX
• Chromosome: 11
• Chromosome location: 11q22.3
• Summary: This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prod

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030229	hsa-miR-26b-5p	Microarray	19088304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	16920334, 32109412
GO:0005515	Function	Protein binding	IPI	30692621
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005739	Component	Mitochondrion	IDA	15123740
GO:0005783	Component	Endoplasmic reticulum	IDA	15123740
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006508	Process	Proteolysis	TAS	7797510
GO:0006915	Process	Apoptotic process	IBA	21873635
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	21873635
GO:0006954	Process	Inflammatory response	IEA
GO:0016540	Process	Protein autoprocessing	IDA	32109412
GO:0032991	Component	Protein-containing complex	IDA	16920334
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0050700	Function	CARD domain binding	IPI	16920334
GO:0050727	Process	Regulation of inflammatory response	IBA	21873635
GO:0050727	Process	Regulation of inflammatory response	IDA	32109412
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	15123740
GO:0070269	Process	Pyroptosis	IDA	32109412
GO:0072557	Component	IPAF inflammasome complex	IBA	21873635
GO:0072559	Component	NLRP3 inflammasome complex	IBA	21873635
GO:0097153	Function	Cysteine-type endopeptidase activity involved in apoptotic process	IBA	21873635
GO:0097169	Component	AIM2 inflammasome complex	IBA	21873635
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IMP	15123740
GO:0097194	Process	Execution phase of apoptosis	IEA
GO:0097199	Function	Cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IBA	21873635
GO:0097200	Function	Cysteine-type endopeptidase activity involved in execution phase of apoptosis	IBA	21873635
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IDA	16920334
GO:1904646	Process	Cellular response to amyloid-beta	IMP	15123740

Other IDs

• MIM: 602664
• HGNC: 1505
• e!Ensembl: ENSG00000196954

Protein

• UniProt ID: P49662
• Protein name: Caspase-4 (CASP-4) (EC 3.4.22.57) (ICE and Ced-3 homolog 2) (ICH-2) (ICE(rel)-II) (Mih1) (Protease TX) [Cleaved into: Caspase-4 subunit p10; Caspase-4 subunit p20]
• Protein function: Inflammatory caspase that acts as the effector of the non-canonical inflammasome by mediating lipopolysaccharide (LPS)-induced pyroptosis (PubMed:25119034, PubMed:26375003, PubMed:32109412, PubMed:34671164, PubMed:37001519, PubMed:37993712, PubM
• PDB: 6KMZ, 6NRY, 7WR0, 7WR1, 7WR4, 7WR5, 7WR6, 8J6K, 8SPB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00619	CARD	3 → 87	Caspase recruitment domain	Domain
  PF00656	Peptidase_C14	136 → 373		Domain

• Sequence:

  MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADS
  MQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKE
  RAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLT
  ARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNN
  RNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF
  IAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMP
  TIERLSMTRYFYLFPGN

• Sequence length: 377

Pathways

KEGG:

Neutrophil extracellular trap formation
NOD-like receptor signaling pathway
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection

Reactome:

NOD1/2 Signaling Pathway

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	21743468