GediPNet logo

C19orf12 (chromosome 19 open reading frame 12)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83636
Gene nameGene Name - the full gene name approved by the HGNC.
Chromosome 19 open reading frame 12
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
C19orf12
SynonymsGene synonyms aliases
MPAN, NBIA3, NBIA4, SPG43
ChromosomeChromosome number
19
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q12
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a small transmembrane protein. Mutations in this gene are a cause of neurodegeneration with brain iron accumulation-4 (NBIA4), but the specific function of the encoded protein is unknown. Alternatively spliced transcript variants encodin
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs146170087 T>C Uncertain-significance, conflicting-interpretations-of-pathogenicity, not-provided, pathogenic Missense variant, genic downstream transcript variant, 3 prime UTR variant, coding sequence variant
rs200133991 C>T Pathogenic, likely-pathogenic 5 prime UTR variant, genic downstream transcript variant, missense variant, coding sequence variant, intron variant
rs201118405 C>G,T Conflicting-interpretations-of-pathogenicity, benign, benign-likely-benign Synonymous variant, 5 prime UTR variant, genic downstream transcript variant, coding sequence variant, intron variant
rs201987973 G>A Pathogenic Genic downstream transcript variant, coding sequence variant, missense variant
rs376103979 C>G,T Pathogenic, likely-pathogenic 5 prime UTR variant, genic downstream transcript variant, missense variant, coding sequence variant, intron variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025866 hsa-miR-7-5p Sequencing 20371350
MIRT042283 hsa-miR-484 CLASH 23622248
MIRT549575 hsa-miR-5197-5p PAR-CLIP 21572407
MIRT549574 hsa-miR-5584-5p PAR-CLIP 21572407
MIRT549573 hsa-miR-6750-5p PAR-CLIP 21572407
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion IDA 23857908, 26136767
GO:0005783 Component Endoplasmic reticulum IDA 23857908, 26136767
GO:0005829 Component Cytosol IDA
GO:0006914 Process Autophagy IMP 26136767
GO:0006915 Process Apoptotic process IMP 26136767
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9NSK7
Protein name Protein C19orf12
Family and domains
Sequence
MERLKSHKPATMTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPP
GLAVGGAVGGLLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTA
LVMGSEALQQQLLAMLVNYVTKELRAEIQYDD
Sequence length 152
Interactions View interactions
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291, rs886041382, rs1057518991, rs1057518699, rs753254213, rs748294403, rs762552974, rs1135401795, rs1553121073, rs1553122926, rs1364690005, rs1554086554, rs1554210415, rs1554168326, rs1554776342, rs1553873247, rs1567860112, rs779009256, rs1557447255, rs1564568350, rs780011005, rs1597464953, rs1200336864, rs1569513017, rs1587459606, rs1570332505, rs748888652, rs1575155995, rs2087029320, rs1589669105, rs1601769604, rs1184981709, rs749201074
Neurodegeneration with brain iron accumulation NEURODEGENERATION WITH BRAIN IRON ACCUMULATION 4 rs121918227, rs587784343, rs121908683, rs121908686, rs515726204, rs397514477, rs515726205, rs387907173, rs387907328, rs387907329, rs387907330, rs387907331, rs387907332, rs386134127, rs386134147, rs398122409, rs140709867, rs587777136, rs121908681, rs730882214, rs797045423, rs797046100, rs797046105, rs797046103, rs797046102, rs797046101, rs869312661, rs201987973, rs878855326, rs530348521, rs886039552, rs1557083958, rs886041994, rs886041382, rs886041693, rs886041381, rs1057519622, rs776936158, rs752450983, rs372350326, rs1064793294, rs1064797235, rs1131691592, rs1135401784, rs765632065, rs915291720, rs1557083878, rs1557084113, rs1557084066, rs1557084120, rs1557083830, rs1557084491, rs1557084239, rs782557596, rs758014228, rs1569263730, rs1569523537, rs1569523502, rs1569523468, rs1567904066, rs766482965, rs1424291552, rs1569523565, rs1569523562, rs1568326754, rs1602539322, rs1599534276, rs1599534394, rs1597713743, rs1282370486, rs1602537159, rs781972464, rs781978699, rs1602538385, rs1602540595, rs1602538148, rs1602538372, rs1602539140, rs1602538379, rs776713955, rs1602538023, rs1602540211, rs1602540331, rs1602540060, rs1602540295, rs2065026878, rs2065034268, rs2065045334, rs2065045650, rs2065032149, rs2065045269 23269600, 21981780, 22704260, 22584950, 23857908, 27604308, 23278385, 26187298, 20039086, 25592411, 22508347, 24209434, 23166001, 23436634, 26539891, 28347615, 26136767, 23521069, 23494994
Optic atrophy Optic Atrophy rs121434508, rs267607017, rs80356524, rs80356525, rs879255560, rs104893753, rs80356529, rs397515360, rs104893620, rs199476104, rs199476112, rs199476118, rs398124298, rs770066665, rs398124299, rs61750185, rs672601379, rs727504060, rs786204830, rs794727804, rs199946797, rs863224127, rs863224131, rs863224134, rs863224906, rs372054380, rs886037828, rs764791523, rs145639028, rs1057519312, rs1064794257, rs1064794656, rs1064797303, rs774265764, rs760337383, rs1553784985, rs72653786, rs1555229948, rs1555119216, rs761743852, rs1553785338, rs1020764190, rs782581701, rs1560408865, rs761460379, rs773022324, rs782740998, rs1560327427, rs80356528, rs1734162973, rs1716524583, rs1057368575
Ovarian cancer Malignant neoplasm of ovary rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828, rs80357208, rs55770810, rs80358165, rs80358010, rs587780226, rs536907995, rs139414606, rs371638537, rs574552037, rs730881647, rs747993448, rs786202125, rs786202962, rs121913321, rs189261858, rs869320800, rs753023295, rs779466229, rs752411477, rs80357438, rs191486604, rs760874290, rs752780954, rs760782298, rs1555591361, rs1555578360, rs1555588460, rs1555587401, rs747427602, rs112675807, rs80357393 21397856
Unknown
Disease name Disease term dbSNP ID References
Bowel incontinence Fecal Incontinence
Dementia Dementia
Distal amyotrophy Distal amyotrophy rs1457770815
Dysarthria Dysarthria

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412