CASP1 (caspase 1)

Gene

• Entrez ID: 834
• Gene name: Caspase 1
• Gene symbol: CASP1
• Synonyms: ICE, IL1BC, P45
• Chromosome: 11
• Chromosome location: 11q22.3
• Summary: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo pro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT642898	hsa-miR-4712-3p	HITS-CLIP	23824327
MIRT642897	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT642896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT642895	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT642894	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT642893	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT642892	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT642891	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT736405	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT642898	hsa-miR-4712-3p	HITS-CLIP	23824327
MIRT642897	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT642896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT642895	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT642894	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT642893	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT642892	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT642891	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT756228	hsa-miR-370-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36735415

Transcription factors

Transcription factor	Regulation	Reference
ETS1	Activation	16103071
TP53	Unknown	11278253

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0004175	Function	Endopeptidase activity	IDA	24548080
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	11821383, 16920334, 32109412, 32553275
GO:0004197	Function	Cysteine-type endopeptidase activity	IGI	15882992
GO:0005515	Function	Protein binding	IPI	11374873, 11390368, 11432859, 11536016, 12888622, 15030775, 15107016, 15383541, 15817483, 15882992, 16575408, 16785446, 17360653, 17418785, 18329368, 18511561, 24630722, 25416956, 25605870, 27043298, 29892012, 30692621
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IDA	12888622, 24548080
GO:0006915	Process	Apoptotic process	IBA	21873635
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	1373520
GO:0008656	Function	Cysteine-type endopeptidase activator activity involved in apoptotic process	TAS	10799503
GO:0010506	Process	Regulation of autophagy	IEA
GO:0016540	Process	Protein autoprocessing	IDA	11821383, 32109412
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019900	Function	Kinase binding	IPI	11432859, 11536016, 15383541
GO:0032611	Process	Interleukin-1 beta production	IGI	15882992
GO:0032730	Process	Positive regulation of interleukin-1 alpha production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	11432859, 11821383
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IMP	11536016, 22267217
GO:0032991	Component	Protein-containing complex	IDA	16920334
GO:0032991	Component	Protein-containing complex	IMP	11536016, 11821383, 15383541
GO:0033198	Process	Response to ATP	IEA
GO:0042802	Function	Identical protein binding	IMP	11432859
GO:0042802	Function	Identical protein binding	IPI	24630722, 27043298
GO:0042981	Process	Regulation of apoptotic process	TAS
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	12761501
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	15383541
GO:0043280	Process	Positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	16920334
GO:0050700	Function	CARD domain binding	IPI	11821383, 16920334
GO:0050727	Process	Regulation of inflammatory response	IBA	21873635
GO:0050727	Process	Regulation of inflammatory response	IDA	32109412, 32553275
GO:0051882	Process	Mitochondrial depolarization	IEA
GO:0060081	Process	Membrane hyperpolarization	IEA
GO:0070269	Process	Pyroptosis	IDA	32109412, 32553275
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	11536016
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071310	Process	Cellular response to organic substance	IDA	19158679
GO:0071345	Process	Cellular response to cytokine stimulus	TAS
GO:0071346	Process	Cellular response to interferon-gamma	IMP	11536016
GO:0072557	Component	IPAF inflammasome complex	IBA	21873635
GO:0072557	Component	IPAF inflammasome complex	ISS
GO:0072558	Component	NLRP1 inflammasome complex	IDA	12191486
GO:0072559	Component	NLRP3 inflammasome complex	IBA	21873635
GO:0072559	Component	NLRP3 inflammasome complex	IDA	15030775
GO:0097153	Function	Cysteine-type endopeptidase activity involved in apoptotic process	IBA	21873635
GO:0097169	Component	AIM2 inflammasome complex	IBA	21873635
GO:0097169	Component	AIM2 inflammasome complex	IDA	19158676
GO:0097179	Component	Protease inhibitor complex	IMP	11432859
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0097194	Process	Execution phase of apoptosis	IEA
GO:0097199	Function	Cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IBA	21873635
GO:0097200	Function	Cysteine-type endopeptidase activity involved in execution phase of apoptosis	IBA	21873635
GO:0097300	Process	Programmed necrotic cell death	IEA
GO:0140448	Process	Signaling receptor ligand precursor processing	IGI	15882992
GO:1901998	Process	Toxin transport	IEA
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IMP	16920334

Other IDs

• MIM: 147678
• HGNC: 1499
• e!Ensembl: ENSG00000137752

Protein

• UniProt ID: P29466
• Protein name: Caspase-1 (CASP-1) (EC 3.4.22.36) (Interleukin-1 beta convertase) (IL-1BC) (Interleukin-1 beta-converting enzyme) (ICE) (IL-1 beta-converting enzyme) (p45) [Cleaved into: Caspase-1 subunit p20; Caspase-1 subunit p10]
• Protein function: Thiol protease involved in a variety of inflammatory processes by proteolytically cleaving other proteins, such as the precursors of the inflammatory cytokines interleukin-1 beta (IL1B) and interleukin 18 (IL18) as well as the pyroptosis inducer
• PDB: 1BMQ, 1IBC, 1ICE, 1RWK, 1RWM, 1RWN, 1RWO, 1RWP, 1RWV, 1RWW, 1RWX, 1SC1, 1SC3, 1SC4, 2FQQ, 2H48, 2H4W, 2H4Y, 2H51, 2H54, 2HBQ, 2HBR, 2HBY, 2HBZ, 3D6F, 3D6H, 3D6M, 3E4C, 3NS7, 5FNA, 5MMV, 5MTK, 6BZ9, 6F6R, 6KN0, 6PZP, 6VIE, 7KEU, 8SV1, 8WRA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00619	CARD	3 → 90	Caspase recruitment domain	Domain
  PF00656	Peptidase_C14	163 → 400		Domain

• Sequence:

  MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
  VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
  PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
  GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
  EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
  VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
  ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

• Sequence length: 404

Pathways

KEGG:

Efferocytosis
Necroptosis
Neutrophil extracellular trap formation
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
C-type lectin receptor signaling pathway
Amyotrophic lateral sclerosis
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Pertussis
Legionellosis
Yersinia infection
Influenza A
Coronavirus disease - COVID-19
Lipid and atherosclerosis

Reactome:

NOD1/2 Signaling Pathway
Interleukin-1 processing
TP53 Regulates Transcription of Caspase Activators and Caspases
The NLRP3 inflammasome
The IPAF inflammasome
Interleukin-37 signaling
Purinergic signaling in leishmaniasis infection

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis, Familial	rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733, rs80356731, rs80356726, rs267606928, rs267606929, rs1885090126, rs121434591, rs121912431, rs121912432, rs121912433, rs121912434, rs121912435, rs121912440, rs121912436, rs121912437, rs121912438, rs121912439, rs74315452, rs121912442, rs121912443, rs121912444, rs121912446, rs121912447, rs1197141604, rs121912448, rs121912449, rs121912450, rs121912451, rs121912452, rs121912453, rs121912454, rs369600566, rs121912455, rs121912456, rs121912457, rs121912458, rs1555836889, rs121909667, rs121909668, rs121909669, rs121909671, rs121909535, rs121909537, rs121909538, rs121909539, rs121909540, rs121909542, rs121909544, rs80356734, rs367543041, rs80356740, rs80356719, rs80356721, rs80356723, rs80356725, rs387906627, rs387906628, rs387906709, rs387906710, rs387906711, rs387906829, rs387907264, rs387907265, rs387907266, rs312262739, rs312262709, rs312262749, rs200793464, rs147713329, rs312262788, rs397514262, rs63751180, rs587777132, rs730880025, rs730880026, rs730880027, rs368743618, rs730880029, rs730882255, rs730882256, rs786205611, rs121912441, rs199947197, rs780136067, rs772731615, rs879253926, rs879254294, rs764717219, rs886041390, rs750159428, rs753207473, rs267607087, rs767350733, rs778305085, rs1554707680, rs1554707622, rs1393363759, rs750959420, rs1555509569, rs1554716504, rs11556620, rs1247392012, rs142083484, rs140385286, rs749428135, rs371575563, rs1402429085, rs1218712729, rs1555179091, rs1555179087, rs746971952, rs1555836950, rs368276916, rs140376902, rs747220413, rs76731700, rs770684782, rs1200906022, rs1804449, rs1482760341, rs769898852, rs140599944, rs757972700, rs1555451521, rs1592362719, rs1555836803, rs763455928, rs1378590183, rs1583695322, rs1362178149, rs1197928094, rs368751524, rs1555509609, rs1574787779, rs1601157750, rs1301635320, rs1341055534, rs1402092579, rs1568809172, rs1555836170, rs1315541036, rs1339283341, rs1643659556, rs1644506661, rs1435710212, rs1553122918, rs1689580631, rs374047961, rs775935265, rs2076486420, rs1820836522, rs757260058, rs1844420892, rs1833371664, rs1833438306, rs1833451208, rs2083790483, rs1303294230, rs1226110412, rs2053207945, rs2053208751, rs2053501632, rs2053539304, rs1567479067, rs544088874, rs1228194239, rs1568807400, rs1169198442, rs2049594204, rs2049594311, rs1568810641, rs1568811372, rs2049618449, rs1476760624, rs2079347087	11796754
Hyperhomocysteinemia	Hyperhomocysteinemia	rs121964962, rs121964963, rs121964964, rs5742905, rs121964966, rs121964967, rs121964968, rs121964969, rs28934891, rs375846341, rs121964972, rs121964973, rs398123151, rs786204466, rs786204679, rs763036586, rs771298943, rs758236584, rs775351239, rs764160782, rs770095972, rs760214620, rs786204757, rs794727083, rs781444670, rs149119723, rs769080151, rs372010465, rs777919630, rs863223432, rs863223430, rs773734233, rs762065361, rs775992753, rs778220779, rs863223435, rs199948079, rs148865119, rs779250698, rs886057100, rs1057516895, rs760417941, rs781567152, rs1057517373, rs766453711, rs763835246, rs755952006, rs1057517083, rs1057516256, rs751464024, rs748695461, rs757920190, rs1064794540, rs1064793703, rs377708532, rs528689432, rs757428597, rs1361324844, rs1347651454, rs1555871188, rs143124288, rs760609383, rs755625628, rs1555876784, rs1555869958, rs1555869979, rs1434118781, rs1555874121, rs763290176, rs1555874803, rs1555875292, rs865990681, rs1000697114, rs1568932835, rs1234354755, rs1170128038, rs1601339216, rs1981524462, rs376916741, rs373782713, rs1983442077	22647887
Kidney disease	Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315	22647887
Lateral sclerosis	AMYOTROPHIC LATERAL SCLEROSIS 1, Amyotrophic Lateral Sclerosis, Sporadic	rs386134181, rs386134176, rs386134174, rs386134184, rs386134178, rs1693780539, rs1574698048	11796754
Multiple sclerosis	Multiple Sclerosis, Multiple Sclerosis, Acute Fulminating	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544	25458313
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	22325453

Unknown
Disease name	Disease term	dbSNP ID	References
Grand mal status epilepticus	Grand Mal Status Epilepticus		18571097
Nonconvulsive status epilepticus	Non-Convulsive Status Epilepticus		18571097
Petit mal status	Petit mal status		18571097
Status epilepticus	Status Epilepticus, Complex Partial Status Epilepticus, Status Epilepticus, Subclinical		18571097