GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

BRAP (BRCA1 associated protein)

Gene

8315

BRCA1 associated protein

BRAP

BRAP2, IMP, RNF52

12q24.12

The protein encoded by this gene was identified by its ability to bind to the nuclear localization signal of BRCA1 and other proteins. It is a cytoplasmic protein which may regulate nuclear targeting by retaining proteins with a nuclear localization signa

Show/Hide all(126)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003364	hsa-miR-221-3p	Reporter assay;Microarray	20018759
MIRT036070	hsa-miR-1296-5p	CLASH	23622248
MIRT716586	hsa-miR-4318	HITS-CLIP	19536157
MIRT716585	hsa-miR-3614-5p	HITS-CLIP	19536157
MIRT716584	hsa-miR-6500-3p	HITS-CLIP	19536157
MIRT716583	hsa-miR-640	HITS-CLIP	19536157
MIRT716582	hsa-miR-4474-3p	HITS-CLIP	19536157
MIRT559183	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT559182	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT559181	hsa-miR-140-5p	PAR-CLIP	21572407
MIRT559180	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT559179	hsa-miR-4761-5p	PAR-CLIP	21572407
MIRT559178	hsa-miR-503-3p	PAR-CLIP	21572407
MIRT559177	hsa-miR-203a-5p	PAR-CLIP	21572407
MIRT559176	hsa-miR-6853-3p	PAR-CLIP	21572407
MIRT559174	hsa-miR-3115	PAR-CLIP	21572407
MIRT559175	hsa-miR-4477a	PAR-CLIP	21572407
MIRT559173	hsa-miR-561-5p	PAR-CLIP	21572407
MIRT559171	hsa-miR-5696	PAR-CLIP	21572407
MIRT559172	hsa-miR-579-3p	PAR-CLIP	21572407
MIRT559170	hsa-miR-664b-3p	PAR-CLIP	21572407
MIRT559169	hsa-miR-5583-3p	PAR-CLIP	21572407
MIRT716586	hsa-miR-4318	HITS-CLIP	19536157
MIRT716585	hsa-miR-3614-5p	HITS-CLIP	19536157
MIRT716584	hsa-miR-6500-3p	HITS-CLIP	19536157
MIRT716583	hsa-miR-640	HITS-CLIP	19536157
MIRT716582	hsa-miR-4474-3p	HITS-CLIP	19536157
MIRT559183	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT559182	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT559181	hsa-miR-140-5p	PAR-CLIP	21572407
MIRT559180	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT559179	hsa-miR-4761-5p	PAR-CLIP	21572407
MIRT559178	hsa-miR-503-3p	PAR-CLIP	21572407
MIRT559177	hsa-miR-203a-5p	PAR-CLIP	21572407
MIRT559176	hsa-miR-6853-3p	PAR-CLIP	21572407
MIRT559174	hsa-miR-3115	PAR-CLIP	21572407
MIRT559175	hsa-miR-4477a	PAR-CLIP	21572407
MIRT559173	hsa-miR-561-5p	PAR-CLIP	21572407
MIRT559171	hsa-miR-5696	PAR-CLIP	21572407
MIRT559172	hsa-miR-579-3p	PAR-CLIP	21572407
MIRT559170	hsa-miR-664b-3p	PAR-CLIP	21572407
MIRT559169	hsa-miR-5583-3p	PAR-CLIP	21572407
MIRT823956	hsa-miR-1236	CLIP-seq
MIRT823957	hsa-miR-1255a	CLIP-seq
MIRT823958	hsa-miR-1255b	CLIP-seq
MIRT823959	hsa-miR-1296	CLIP-seq
MIRT823960	hsa-miR-2113	CLIP-seq
MIRT823961	hsa-miR-23a	CLIP-seq
MIRT823962	hsa-miR-23b	CLIP-seq
MIRT823963	hsa-miR-23c	CLIP-seq
MIRT823964	hsa-miR-2909	CLIP-seq
MIRT823965	hsa-miR-3122	CLIP-seq
MIRT823966	hsa-miR-3146	CLIP-seq
MIRT823967	hsa-miR-3171	CLIP-seq
MIRT823968	hsa-miR-3611	CLIP-seq
MIRT823969	hsa-miR-3913-5p	CLIP-seq
MIRT823970	hsa-miR-3921	CLIP-seq
MIRT823971	hsa-miR-4251	CLIP-seq
MIRT823972	hsa-miR-4286	CLIP-seq
MIRT823973	hsa-miR-4329	CLIP-seq
MIRT823974	hsa-miR-4512	CLIP-seq
MIRT823975	hsa-miR-4522	CLIP-seq
MIRT823976	hsa-miR-4637	CLIP-seq
MIRT823977	hsa-miR-4653-5p	CLIP-seq
MIRT823978	hsa-miR-4672	CLIP-seq
MIRT823979	hsa-miR-4714-5p	CLIP-seq
MIRT823980	hsa-miR-4735-5p	CLIP-seq
MIRT823981	hsa-miR-4749-3p	CLIP-seq
MIRT823982	hsa-miR-4753-3p	CLIP-seq
MIRT823983	hsa-miR-539	CLIP-seq
MIRT823984	hsa-miR-550b	CLIP-seq
MIRT823985	hsa-miR-576-5p	CLIP-seq
MIRT823986	hsa-miR-758	CLIP-seq
MIRT823959	hsa-miR-1296	CLIP-seq
MIRT1943596	hsa-miR-1321	CLIP-seq
MIRT1943597	hsa-miR-137	CLIP-seq
MIRT1943598	hsa-miR-181a	CLIP-seq
MIRT1943599	hsa-miR-181b	CLIP-seq
MIRT1943600	hsa-miR-181c	CLIP-seq
MIRT1943601	hsa-miR-181d	CLIP-seq
MIRT823964	hsa-miR-2909	CLIP-seq
MIRT1943602	hsa-miR-3065-3p	CLIP-seq
MIRT1943603	hsa-miR-3117-5p	CLIP-seq
MIRT1943604	hsa-miR-3143	CLIP-seq
MIRT1943605	hsa-miR-3162-5p	CLIP-seq
MIRT1943606	hsa-miR-3606	CLIP-seq
MIRT1943607	hsa-miR-3925-3p	CLIP-seq
MIRT1943608	hsa-miR-3942-3p	CLIP-seq
MIRT1943609	hsa-miR-4262	CLIP-seq
MIRT1943610	hsa-miR-4476	CLIP-seq
MIRT823974	hsa-miR-4512	CLIP-seq
MIRT1943611	hsa-miR-4698	CLIP-seq
MIRT1943612	hsa-miR-4739	CLIP-seq
MIRT1943613	hsa-miR-4756-5p	CLIP-seq
MIRT1943614	hsa-miR-522	CLIP-seq
MIRT1943615	hsa-miR-543	CLIP-seq
MIRT1943616	hsa-miR-766	CLIP-seq
MIRT1943617	hsa-miR-921	CLIP-seq
MIRT2182262	hsa-miR-1178	CLIP-seq
MIRT2182263	hsa-miR-1205	CLIP-seq
MIRT2182264	hsa-miR-128	CLIP-seq
MIRT2182265	hsa-miR-132	CLIP-seq
MIRT1943596	hsa-miR-1321	CLIP-seq
MIRT1943597	hsa-miR-137	CLIP-seq
MIRT2182266	hsa-miR-154	CLIP-seq
MIRT2182267	hsa-miR-212	CLIP-seq
MIRT2182268	hsa-miR-217	CLIP-seq
MIRT2182269	hsa-miR-27a	CLIP-seq
MIRT2182270	hsa-miR-27b	CLIP-seq
MIRT1943603	hsa-miR-3117-5p	CLIP-seq
MIRT1943605	hsa-miR-3162-5p	CLIP-seq
MIRT2182271	hsa-miR-340	CLIP-seq
MIRT2182272	hsa-miR-342-3p	CLIP-seq
MIRT2182273	hsa-miR-3665	CLIP-seq
MIRT2182274	hsa-miR-4270	CLIP-seq
MIRT2182275	hsa-miR-4275	CLIP-seq
MIRT2182276	hsa-miR-4418	CLIP-seq
MIRT2182277	hsa-miR-4441	CLIP-seq
MIRT1943610	hsa-miR-4476	CLIP-seq
MIRT2182278	hsa-miR-4639-3p	CLIP-seq
MIRT1943612	hsa-miR-4739	CLIP-seq
MIRT1943613	hsa-miR-4756-5p	CLIP-seq
MIRT2182279	hsa-miR-4773	CLIP-seq
MIRT2182280	hsa-miR-509-3-5p	CLIP-seq
MIRT2182281	hsa-miR-509-5p	CLIP-seq
MIRT2182282	hsa-miR-657	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IDA	14724641
GO:0000165	Process	MAPK cascade	IDA	14724641
GO:0000165	Process	MAPK cascade	TAS
GO:0003676	Function	Nucleic acid binding	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	14724641
GO:0005515	Function	Protein binding	IPI	9497340, 14724641, 25820252, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	9497340
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007265	Process	Ras protein signal transduction	IDA	14724641
GO:0008139	Function	Nuclear localization sequence binding	IDA	9497340
GO:0008270	Function	Zinc ion binding	IEA
GO:0009968	Process	Negative regulation of signal transduction	IDA	14724641
GO:0016567	Process	Protein ubiquitination	IDA	14724641
GO:0016567	Process	Protein ubiquitination	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0042802	Function	Identical protein binding	IPI	14724641, 25820252
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	14724641
GO:0061630	Function	Ubiquitin protein ligase activity	TAS

MIM	HGNC	e!Ensembl
604986	1099	ENSG00000089234

Protein

UniProt ID

Q7Z569

Protein name

BRCA1-associated protein (EC 2.3.2.27) (BRAP2) (Impedes mitogenic signal propagation) (IMP) (RING finger protein 52) (RING-type E3 ubiquitin transferase BRAP2) (Renal carcinoma antigen NY-REN-63)

Protein function

Negatively regulates MAP kinase activation by limiting the formation of Raf/MEK complexes probably by inactivation of the KSR1 scaffold protein. Also acts as a Ras responsive E3 ubiquitin ligase that, on activation of Ras, is modified by auto-po

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07576	BRAP2	154 → 252	BRCA1-associated protein 2	Family
PF13639	zf-RING_2	262 → 304	Ring finger domain	Domain
PF02148	zf-UBP	317 → 379	Zn-finger in ubiquitin-hydrolases and other protein	Domain

Sequence

MSVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAII
HQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSK
QLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKF
VAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVE
RAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTC
PVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQL
TNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQR
IYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKV
AKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYL
ETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRSKRGK

Sequence length

592

Interactions

View interactions

	KEGG		Reactome
	Ras signaling pathway		RAF activation Negative regulation of MAPK pathway Signaling by moderate kinase activity BRAF mutants Paradoxical activation of RAF signaling by kinase inactive BRAF Signaling downstream of RAS mutants

Associated diseases

Show/Hide Causal Diseases (3)

Causal
Disease name	Disease term	dbSNP ID	References
Esophagus neoplasm	Malignant neoplasm of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	21642993
Myocardial infarction	Myocardial Infarction	rs12316150, rs41303970, rs909253, rs7291467, rs2234693	24916648, 19198608, 21107343
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	24454952

Show/Hide Unknown Diseases (1)

Unknown
Disease name	Disease term	dbSNP ID	References
Coronary heart disease	Coronary heart disease	rs9289231, rs281864746	21971053, 23364394

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412