GediPNet logo

LAGE3 (L antigen family member 3)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8270
Gene nameGene Name - the full gene name approved by the HGNC.
L antigen family member 3
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
LAGE3
SynonymsGene synonyms aliases
CVG5, DXS9879E, DXS9951E, ESO3, GAMOS2, ITBA2, Pcc1
ChromosomeChromosome number
X
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq28
SummarySummary of gene provided in NCBI Entrez Gene.
This gene belongs to the ESO/LAGE gene family, members of which are clustered together on chromosome Xq28, and have similar exon-intron structures. Unlike the other family members which are normally expressed only in testis and activated in a wide range o
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1557211306 C>A Pathogenic Missense variant, coding sequence variant
rs1557211410 C>T Pathogenic Splice donor variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1103148 hsa-miR-1915 CLIP-seq
MIRT1103149 hsa-miR-2392 CLIP-seq
MIRT1103150 hsa-miR-3074-5p CLIP-seq
MIRT1103151 hsa-miR-3157-3p CLIP-seq
MIRT1103152 hsa-miR-3673 CLIP-seq
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000408 Component EKC/KEOPS complex IBA 21873635
GO:0000408 Component EKC/KEOPS complex IDA 27903914, 28805828
GO:0005515 Function Protein binding IPI 25416956, 27903914, 28514442, 31481669, 32296183
GO:0005634 Component Nucleus IDA 28805828
GO:0005654 Component Nucleoplasm IDA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q14657
Protein name EKC/KEOPS complex subunit LAGE3 (L antigen family member 3) (Protein ESO-3) (Protein ITBA2)
Protein function Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably
PDB 6GWJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09341 Pcc1
62 135
Transcription factor Pcc1
Family
Sequence
MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRP
HIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISV
INFLDQLSLVVRTMQ
RFGPPVSR
Sequence length 143
Interactions View interactions
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291, rs886041382, rs1057518991, rs1057518699, rs753254213, rs748294403, rs762552974, rs1135401795, rs1553121073, rs1553122926, rs1364690005, rs1554086554, rs1554210415, rs1554168326, rs1554776342, rs1553873247, rs1567860112, rs779009256, rs1557447255, rs1564568350, rs780011005, rs1597464953, rs1200336864, rs1569513017, rs1587459606, rs1570332505, rs748888652, rs1575155995, rs2087029320, rs1589669105, rs1601769604, rs1184981709, rs749201074
Galloway-mowat syndrome Galloway Mowat syndrome, GALLOWAY-MOWAT SYNDROME 2, X-LINKED, Galloway-Mowat syndrome rs727502863, rs727502864, rs730882216, rs797044992, rs767086146, rs754099015, rs797044993, rs797044994, rs797044995, rs863223396, rs869320712, rs776760122, rs1555976610, rs1557211306, rs1557211209, rs1557211410, rs1431526147, rs1432218739, rs773814837, rs1233885358, rs753237335, rs140076803, rs1555331969, rs144732839, rs1443735811, rs374322839, rs773173317, rs140583554, rs1292041526, rs1569314907, rs779449710, rs1433513056, rs745342141, rs866551482, rs1282630153, rs1596050297, rs774069989 28805828
Glomerulonephritis Glomerulonephritis, Glomerulonephritis, Minimal Change rs778043831
Kidney disease Kidney Diseases rs74315342, rs749740335, rs757649673, rs112417755, rs35138315
Unknown
Disease name Disease term dbSNP ID References
Aqueductal stenosis Aqueductal Stenosis
Arachnodactyly Arachnodactyly
Cerebellar atrophy Cerebellar atrophy
Cerebral atrophy Cerebral atrophy

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412