SHARPIN (SHANK associated RH domain interactor)

Gene

• Entrez ID: 81858
• Gene name: SHANK associated RH domain interactor
• Gene symbol: SHARPIN
• Synonyms: AIFID, SIPL1
• Chromosome: 8
• Chromosome location: 8q24.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2622312	hsa-miR-1254	CLIP-seq
MIRT2622313	hsa-miR-1270	CLIP-seq
MIRT2622314	hsa-miR-199a-3p	CLIP-seq
MIRT2622315	hsa-miR-199b-3p	CLIP-seq
MIRT2622316	hsa-miR-2861	CLIP-seq
MIRT2622317	hsa-miR-3116	CLIP-seq
MIRT2622318	hsa-miR-3129-5p	CLIP-seq
MIRT2622319	hsa-miR-4254	CLIP-seq
MIRT2622320	hsa-miR-4274	CLIP-seq
MIRT2622321	hsa-miR-4276	CLIP-seq
MIRT2622322	hsa-miR-4447	CLIP-seq
MIRT2622323	hsa-miR-4472	CLIP-seq
MIRT2622324	hsa-miR-4488	CLIP-seq
MIRT2622325	hsa-miR-4683	CLIP-seq
MIRT2622326	hsa-miR-4697-5p	CLIP-seq
MIRT2622327	hsa-miR-4707-5p	CLIP-seq
MIRT2622328	hsa-miR-620	CLIP-seq
MIRT2622329	hsa-miR-936	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IBA	21873635
GO:0004842	Function	Ubiquitin-protein transferase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	21455173, 21455180, 21455181, 21709223, 21947080, 22158122, 23032186, 23104095, 24141947, 27070702, 28514442, 30561431
GO:0005829	Component	Cytosol	IDA	20179993
GO:0005829	Component	Cytosol	TAS
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	TAS
GO:0007420	Process	Brain development	IEA
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	IDA	21455173
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	TAS
GO:0014069	Component	Postsynaptic density	IEA
GO:0030262	Process	Apoptotic nuclear changes	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031424	Process	Keratinization	IEA
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	IDA	21455173, 21455181
GO:0042802	Function	Identical protein binding	IEA
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	21873635
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	21455173
GO:0043130	Function	Ubiquitin binding	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0071797	Component	LUBAC complex	IBA	21873635
GO:0071797	Component	LUBAC complex	IDA	21455173, 21455180, 21455181, 24726323, 27523608
GO:0097039	Process	Protein linear polyubiquitination	IBA	21873635
GO:0097039	Process	Protein linear polyubiquitination	IDA	21455173, 21455180, 21455181
GO:2000348	Process	Regulation of CD40 signaling pathway	IDA	21455173

Other IDs

• MIM: 611885
• HGNC: 25321
• e!Ensembl: ENSG00000179526

Protein

• UniProt ID: Q9H0F6
• Protein name: Sharpin (Shank-associated RH domain-interacting protein) (Shank-interacting protein-like 1) (hSIPL1)
• Protein function: Component of the LUBAC complex which conjugates linear polyubiquitin chains in a head-to-tail manner to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation (PubMed:21455173, PubMed:21455180, PubMed:21455181).
• PDB: 4EMO, 5X0W, 8K6P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16764	Sharpin_PH	15 → 127	Sharpin PH domain	Domain

• Sequence:

  MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLEL
  LGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGAT
  VEGQNGSKSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLA
  RAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPGPIRLQVTLEDAASAASAASSAHV
  ALQVHPHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPERSLASYGVRQDGDPAFLYLL
  SAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQPSWSCPSCTFI
  NAPDRPGCEMCSTQRPCTWDPLAAAST

• Sequence length: 387

Pathways

KEGG:

Necroptosis
NOD-like receptor signaling pathway
Shigellosis

Reactome:

Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Dermatitis	Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	19650867

Unknown
Disease name	Disease term	dbSNP ID	References
Eosinophilia	Eosinophilia, Eosinophilia, Tropical		19650867
Respiratory tract diseases	Respiratory Tract Diseases		30595370