ST6GALNAC5 (ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 5)

Gene

• Entrez ID: 81849
• Gene name: ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
• Gene symbol: ST6GALNAC5
• Synonyms: SIAT7-E, SIAT7E, ST6GalNAcV
• Chromosome: 1
• Chromosome location: 1p31.1
• Summary: The protein encoded by this gene is a Golgi type II transmembrane glycosyltransferase. The encoded protein catalyzes the transfer of sialic acid to cell surface proteins to modulate cell-cell interactions. Several transcript variants encoding different is

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019483	hsa-miR-148b-3p	Microarray	17612493
MIRT725137	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT725136	hsa-miR-3688-3p	HITS-CLIP	19536157
MIRT725135	hsa-miR-5093	HITS-CLIP	19536157
MIRT725137	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT725136	hsa-miR-3688-3p	HITS-CLIP	19536157
MIRT725135	hsa-miR-5093	HITS-CLIP	19536157
MIRT1393771	hsa-miR-1276	CLIP-seq
MIRT1393772	hsa-miR-219-2-3p	CLIP-seq
MIRT1393773	hsa-miR-2278	CLIP-seq
MIRT1393774	hsa-miR-2964a-3p	CLIP-seq
MIRT1393775	hsa-miR-3130-3p	CLIP-seq
MIRT1393776	hsa-miR-4328	CLIP-seq
MIRT1393777	hsa-miR-4680-3p	CLIP-seq
MIRT1393778	hsa-miR-4793-3p	CLIP-seq
MIRT1393779	hsa-miR-520d-5p	CLIP-seq
MIRT1393780	hsa-miR-524-5p	CLIP-seq
MIRT1393781	hsa-miR-544	CLIP-seq
MIRT2118218	hsa-miR-576-3p	CLIP-seq
MIRT2340200	hsa-miR-3140-3p	CLIP-seq
MIRT2340201	hsa-miR-377	CLIP-seq
MIRT2340202	hsa-miR-4789-3p	CLIP-seq
MIRT1393779	hsa-miR-520d-5p	CLIP-seq
MIRT1393780	hsa-miR-524-5p	CLIP-seq
MIRT1393781	hsa-miR-544	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001574	Process	Ganglioside biosynthetic process	IBA	21873635
GO:0001665	Function	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IBA	21873635
GO:0001665	Function	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	ISS
GO:0006486	Process	Protein glycosylation	IEA
GO:0006688	Process	Glycosphingolipid biosynthetic process	ISS
GO:0008373	Function	Sialyltransferase activity	ISS	12668675
GO:0009311	Process	Oligosaccharide metabolic process	IBA	21873635
GO:0009312	Process	Oligosaccharide biosynthetic process	ISS	12668675
GO:0016021	Component	Integral component of membrane	IEA
GO:0097503	Process	Sialylation	IEA

Other IDs

• MIM: 610134
• HGNC: 19342
• e!Ensembl: ENSG00000117069

Protein

• UniProt ID: Q9BVH7
• Protein name: Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 (EC 2.4.99.-) (GD1 alpha synthase) (GalNAc alpha-2,6-sialyltransferase V) (ST6GalNAc V) (ST6GalNAcV) (Sialyltransferase 7E) (SIAT7-E)
• Protein function: Predominantly catalyzes the biosynthesis of ganglioside GD1alpha from GM1b in the brain, by transferring the sialyl group (N-acetyl-alpha-neuraminyl or NeuAc) from CMP-NeuAc to the GalNAc residue on the NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc sequen
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00777	Glyco_transf_29	79 → 317	Glycosyltransferase family 29 (sialyltransferase)	Family

• Sequence:

  MKTLMRHGLAVCLALTTMCTSLLLVYSSLGGQKERPPQQQQQQQQQQQQASATGSSQPAA
  ESSTQQRPGVPAGPRPLDGYLGVADHKPLKMHCRDCALVTSSGHLLHSRQGSQIDQTECV
  IRMNDAPTRGYGRDVGNRTSLRVIAHSSIQRILRNRHDLLNVSQGTVFIFWGPSSYMRRD
  GKGQVYNNLHLLSQVLPRLKAFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTI
  ALELCDRINVYGMVPPDFCRDPNHPSVPYHYYEPFGPDECTMYLSHERGRKGSHHRFITE
  KRVFKNWARTFNIHFFQPDWKPESLAINHPENKPVF

• Sequence length: 336

Pathways

KEGG:

Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways

Reactome:

Sialic acid metabolism

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	27903959
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	17379860, 17568789