GediPNet logo

CDT1 (chromatin licensing and DNA replication factor 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
81620
Gene nameGene Name - the full gene name approved by the HGNC.
Chromatin licensing and DNA replication factor 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CDT1
SynonymsGene synonyms aliases
DUP, RIS2
ChromosomeChromosome number
16
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q24.3
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for DNA replication. The encoded protein can bind geminin, which prevents replication and may function to prevent this protein from initiating r
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs3218727 C>T Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs144843732 A>T Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs147914553 C>A,G,T Pathogenic Coding sequence variant, stop gained, synonymous variant
rs200652608 G>A,C Pathogenic Missense variant, coding sequence variant
rs387906917 G>A Likely-pathogenic, pathogenic Missense variant, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016534 hsa-miR-193b-3p Microarray 20304954
MIRT050529 hsa-miR-20a-5p CLASH 23622248
MIRT045201 hsa-miR-186-5p CLASH 23622248
MIRT635630 hsa-miR-1228-3p HITS-CLIP 19536157
MIRT718835 hsa-miR-660-3p HITS-CLIP 19536157
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000076 Process DNA replication checkpoint IBA 21873635
GO:0000076 Process DNA replication checkpoint IDA 14672932
GO:0000082 Process G1/S transition of mitotic cell cycle TAS
GO:0000083 Process Regulation of transcription involved in G1/S transition of mitotic cell cycle TAS
GO:0000278 Process Mitotic cell cycle IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9H211
Protein name DNA replication factor Cdt1 (Double parked homolog) (DUP)
Protein function Required for both DNA replication and mitosis (PubMed:11125146, PubMed:14993212, PubMed:21856198, PubMed:22581055, PubMed:26842564). DNA replication licensing factor, required for pre-replication complex assembly. Cooperates with CDC6 and the or
PDB 2LE8 , 2WVR , 6QCG , 8RWV , 8S0E , 8S0F
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08839 CDT1
186 349
DNA replication factor CDT1 like
Domain
PF16679 CDT1_C
421 516
DNA replication factor Cdt1 C-terminal domain
Domain
Sequence
MEQRRVTDFFARRRPGPPRIAPPKLACRTPSPARPALRAPASATSGSRKRARPPAAPGRD
QARPPARRRLRLSVDEVSSPSTPEAPDIPACPSPGQKIKKSTPAAGQPPHLTSAQDQDTI
SELASCLQRARELGARVRALKASAQDAGESCTPEAEGRPEEPCGEKAPAYQRFHALAQPG
LPGLVLPYKYQVLAEMFRSMDTIVGMLHNRSETPTFAKVQRGVQDMMRRRFEECNVGQIK
TVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEADGAAPQLTASRLLQRRQIFSQ
KLVEHVKEHHKAFLASLSPAMVVPEDQLTRWHPRFNVDEVPDIEPAALP
QPPATEKLTTA
QEVLARARNLISPRMEKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQ
DLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLPELARVLRSVFVSERKPALSMEVACA
RMVGSCCTIMSPGEMEKHLLLLSELLPDWLSLHRIR
TDTYVKLDKAADLAHITARLAHQT
RAEEGL
Sequence length 546
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Cell cycle   CDT1 association with the CDC6:ORC:origin complex
Assembly of the pre-replicative complex
Orc1 removal from chromatin
Activation of the pre-replicative complex
G1/S-Specific Transcription
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Craniosynostosis Craniosynostosis rs104893895, rs587777006, rs587777007, rs587777008, rs587777010, rs281865153, rs281865154, rs864321680, rs864321681, rs1057517670, rs1085307122, rs1064794325, rs1884302, rs1555750816, rs1599823350
Cryptorchidism Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291, rs886041382, rs1057518991, rs1057518699, rs753254213, rs748294403, rs762552974, rs1135401795, rs1553121073, rs1553122926, rs1364690005, rs1554086554, rs1554210415, rs1554168326, rs1554776342, rs1553873247, rs1567860112, rs779009256, rs1557447255, rs1564568350, rs780011005, rs1597464953, rs1200336864, rs1569513017, rs1587459606, rs1570332505, rs748888652, rs1575155995, rs2087029320, rs1589669105, rs1601769604, rs1184981709, rs749201074
Meier-gorlin syndrome MEIER-GORLIN SYNDROME 4 rs121918494, rs387906826, rs143141689, rs387906828, rs1557573504, rs1378348220, rs387906842, rs387906847, rs797044461, rs387906917, rs147914553, rs779871947, rs387906918, rs200652608, rs786205258, rs387906969, rs587780305, rs864309486, rs864309487, rs864309488, rs797045852, rs1085307083, rs754080445, rs879255632, rs879255633, rs146559223, rs879255692, rs1131692169, rs777153067, rs751663397, rs752023208 21358632, 15286659, 21358631
Unknown
Disease name Disease term dbSNP ID References
Camptodactyly of fingers Clinodactyly of the 5th finger
Breast aplasia Congenital absence of breast
Anotia Congenital absence of external ear
Mandibular aplasia Congenital absence of mandible

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412