FIP1L1 (factor interacting with PAPOLA and CPSF1)

Gene

• Entrez ID: 81608
• Gene name: Factor interacting with PAPOLA and CPSF1
• Gene symbol: FIP1L1
• Synonyms: FIP1, Rhe, hFip1
• Chromosome: 4
• Chromosome location: 4q12
• Summary: This gene encodes a subunit of the CPSF (cleavage and polyadenylation specificity factor) complex that polyadenylates the 3` end of mRNA precursors. This gene, the homolog of yeast Fip1 (factor interacting with PAP), binds to U-rich sequences of pre-mRNA

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020609	hsa-miR-155-5p	Proteomics	18668040
MIRT036936	hsa-miR-877-3p	CLASH	23622248
MIRT996944	hsa-miR-3682-5p	CLIP-seq
MIRT996945	hsa-miR-4490	CLIP-seq
MIRT996946	hsa-miR-4731-3p	CLIP-seq
MIRT996947	hsa-miR-4774-5p	CLIP-seq
MIRT996948	hsa-miR-4789-5p	CLIP-seq
MIRT996949	hsa-miR-4801	CLIP-seq
MIRT2533548	hsa-miR-1261	CLIP-seq
MIRT2533549	hsa-miR-142-5p	CLIP-seq
MIRT2533550	hsa-miR-23a	CLIP-seq
MIRT2533551	hsa-miR-23b	CLIP-seq
MIRT2533552	hsa-miR-23c	CLIP-seq
MIRT2533553	hsa-miR-3201	CLIP-seq
MIRT2533554	hsa-miR-340	CLIP-seq
MIRT2533555	hsa-miR-4317	CLIP-seq
MIRT2533556	hsa-miR-432	CLIP-seq
MIRT2533557	hsa-miR-4791	CLIP-seq
MIRT2533558	hsa-miR-511	CLIP-seq
MIRT2533559	hsa-miR-578	CLIP-seq
MIRT2533560	hsa-miR-616	CLIP-seq
MIRT2533561	hsa-miR-626	CLIP-seq
MIRT2533548	hsa-miR-1261	CLIP-seq
MIRT2533549	hsa-miR-142-5p	CLIP-seq
MIRT2533550	hsa-miR-23a	CLIP-seq
MIRT2533551	hsa-miR-23b	CLIP-seq
MIRT2533552	hsa-miR-23c	CLIP-seq
MIRT2533553	hsa-miR-3201	CLIP-seq
MIRT2533554	hsa-miR-340	CLIP-seq
MIRT2533556	hsa-miR-432	CLIP-seq
MIRT2533557	hsa-miR-4791	CLIP-seq
MIRT2533559	hsa-miR-578	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000398	Process	MRNA splicing, via spliceosome	TAS
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	15937220, 19224921, 25416956, 29276085
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005847	Component	MRNA cleavage and polyadenylation specificity factor complex	IBA	21873635
GO:0006369	Process	Termination of RNA polymerase II transcription	TAS
GO:0006378	Process	MRNA polyadenylation	IBA	21873635
GO:0006406	Process	MRNA export from nucleus	TAS
GO:0031124	Process	MRNA 3'-end processing	TAS
GO:0098789	Process	Pre-mRNA cleavage required for polyadenylation	IBA	21873635

Other IDs

• MIM: 607686
• HGNC: 19124
• e!Ensembl: ENSG00000145216

Protein

• UniProt ID: Q6UN15
• Protein name: Pre-mRNA 3'-end-processing factor FIP1 (hFip1) (FIP1-like 1 protein) (Factor interacting with PAP) (Rearranged in hypereosinophilia)
• Protein function: Component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about c
• PDB: 7K95, 7ZY4, 7ZYH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05182	Fip1	154 → 196	Fip1 motif	Motif

• Sequence:

  MSAGEVERLVSELSGGTGGDEEEEWLYGGPWDVHVHSDLAKDLDENEVERPEEENASANP
  PSGIEDETAENGVPKPKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNL
  NIKTGGRVYGTTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGF
  NEDTWKAYCEKQKRIRMGLEVIPVTSTTNKITAEDCTMEVTPGAEIQDGRFNLFKVQQGR
  TGNSEKETALPSTKAEFTSPPSLFKTGLPPSRNSTSSQSQTSTASRKANSSVGKWQDRYG
  RAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFF
  PPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTIESGHSSGYDSRS
  ARAFPYGNVAFPHLPGSAPSWPSLVDTSKQWDYYARREKDRDRERDRDRERDRDRDRERE
  RTRERERERDHSPTPSVFNSDEERYRYREYAERGYERHRASREKEERHRERRHREKEETR
  HKSSRSNSRRRHESEEGDSHRRHKHKKSKRSKEGKEAGSEPAPEQESTEATPAE

• Sequence length: 594

Pathways

KEGG:

mRNA surveillance pathway

Reactome:

Transport of Mature mRNA Derived from an Intronless Transcript
mRNA Splicing - Major Pathway
mRNA 3'-end processing
RNA Polymerase II Transcription Termination
Processing of Intronless Pre-mRNAs
Signaling by cytosolic PDGFRA and PDGFRB fusion proteins

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Anemia	Anemia	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505
Hypofibrinogenemia	Hypofibrinogenemia	rs121913087, rs121913088, rs587776837, rs121909616, rs121909625, rs121909608, rs121909607, rs146387238, rs1578795296, rs1214070111, rs776817952, rs762964798, rs121909606, rs1414035000, rs1310452604
Myocardial infarction	Myocardial Failure	rs12316150, rs41303970, rs909253, rs7291467, rs2234693	28347583
Neutropenia	Neutropenia	rs879253882
Pancytopenia	Pancytopenia	rs869312883, rs770551610, rs1131690788, rs530073586, rs374333820

Unknown
Disease name	Disease term	dbSNP ID	References
Anorexia	Anorexia
Congestive heart failure	Congestive heart failure	rs2301610, rs3833910, rs12301951, rs201674674, rs186741807, rs150140412, rs786205727, rs757840030, rs552050895, rs759465783, rs201978086, rs572757800, rs1572143354, rs749160569	28347583
Diffuse alveolar hemorrhage	Diffuse alveolar hemorrhage
Disseminated intravascular coagulation	Disseminated Intravascular Coagulation
Eosinophilic leukemia	Eosinophilic leukemia, Chronic eosinophilic leukemia		16778211, 28347583, 24764730, 22523564, 16502585, 17988989
Fibrinogen deficiency	Fibrinogen Deficiency
Gangrene	Gangrene
Heart failure	Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided	rs121918074, rs142027794, rs148791216, rs72648927, rs71578935, rs142416150, rs199830512, rs755445214, rs150102469, rs779568205, rs907992794, rs1202130741	28347583
Hypereosinophilic syndrome	Idiopathic Hypereosinophilic Syndrome, Hypereosinophilic syndrome, Primary hypereosinophilic syndrome	rs181854060, rs77524207, rs150577828, rs139236922, rs35597368, rs36035373, rs200042995, rs149951350, rs139913632, rs200033396, rs541057765, rs61735622, rs199827643, rs142498442, rs138519829, rs754092062, rs35805947, rs140725151, rs55966236, rs56026726, rs149031291, rs761924292, rs55830582, rs199902153, rs56384252, rs138150216, rs55996208, rs148629782, rs55947416, rs2229307, rs4358459, rs1873778, rs10028020, rs2228230, rs7685117, rs1799767, rs886059444, rs754623338, rs375050626, rs141346675, rs886059451, rs886059452, rs757111915, rs886059456, rs55710909, rs565989173, rs748063948, rs886059459, rs777478254, rs10034498, rs886059460, rs547925170, rs145549583, rs886059443, rs151259376, rs142492533, rs563016888, rs886059446, rs555347387, rs750090756, rs3690, rs566508858, rs56288633, rs1565664, rs145328998, rs187821520, rs368579295, rs574665425, rs886059461, rs886059462, rs533627398, rs183431225, rs78405886, rs886059445, rs886059447, rs878854837, rs771421611, rs55681376, rs7680422, rs886059450, rs886059448, rs886059449, rs12511976, rs373134586, rs557191329, rs34529347, rs886059457, rs554089461, rs544503522, rs138584193, rs752208389, rs886059458, rs184179322, rs149631103, rs377126983, rs886059463, rs137930765, rs61735621, rs778161572, rs1060504254, rs190260215, rs373948582, rs773679384, rs774431464, rs1218651787, rs778510648, rs779173667	16778211, 28347583
Leukopenia	Leukopenia
Loeffler`s endocarditis	Loeffler`s Endocarditis		16778211, 28347583
Promyelocytic leukemia	Acute Promyelocytic Leukemia		18603554
Stomatitis	Stomatitis