TCL1A (TCL1 family AKT coactivator A)

Gene

• Entrez ID: 8115
• Gene name: TCL1 family AKT coactivator A
• Gene symbol: TCL1A
• Synonyms: TCL1
• Chromosome: 14
• Chromosome location: 14q32.13
• Summary: Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004510	hsa-miR-29b-3p	Luciferase reporter assay	17707831
MIRT004510	hsa-miR-29b-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	17178851
MIRT005106	hsa-miR-181b-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	17178851
MIRT005106	hsa-miR-181b-5p	Western blot	17178851
MIRT004510	hsa-miR-29b-3p	Western blot	17178851
MIRT1416611	hsa-miR-1207-5p	CLIP-seq
MIRT1416612	hsa-miR-3189-3p	CLIP-seq
MIRT1416613	hsa-miR-4433	CLIP-seq
MIRT1416614	hsa-miR-4473	CLIP-seq
MIRT1416615	hsa-miR-4536	CLIP-seq
MIRT1416616	hsa-miR-4722-5p	CLIP-seq
MIRT1416617	hsa-miR-4736	CLIP-seq
MIRT1416618	hsa-miR-4763-3p	CLIP-seq
MIRT1416619	hsa-miR-512-3p	CLIP-seq
MIRT1416620	hsa-miR-520f	CLIP-seq
MIRT2347364	hsa-miR-1912	CLIP-seq
MIRT2347365	hsa-miR-3138	CLIP-seq
MIRT2347366	hsa-miR-3619-3p	CLIP-seq
MIRT2347367	hsa-miR-4251	CLIP-seq
MIRT2347368	hsa-miR-4491	CLIP-seq
MIRT2347369	hsa-miR-4657	CLIP-seq
MIRT2347370	hsa-miR-4764-5p	CLIP-seq
MIRT2347371	hsa-miR-4776-5p	CLIP-seq
MIRT2347372	hsa-miR-4800-5p	CLIP-seq
MIRT2347373	hsa-miR-539	CLIP-seq
MIRT2395594	hsa-miR-1205	CLIP-seq
MIRT2395595	hsa-miR-4417	CLIP-seq
MIRT2395596	hsa-miR-4438	CLIP-seq
MIRT2395597	hsa-miR-4514	CLIP-seq
MIRT2395598	hsa-miR-4692	CLIP-seq
MIRT1416617	hsa-miR-4736	CLIP-seq
MIRT2395599	hsa-miR-5095	CLIP-seq
MIRT2395600	hsa-miR-548v	CLIP-seq
MIRT2395601	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 16934922, 19064921, 21516116, 25416956, 25910212, 26871637, 27107012, 29997244, 31515488, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005829	Component	Cytosol	IDA
GO:0007275	Process	Multicellular organism development	TAS	7809072
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10983986
GO:0010918	Process	Positive regulation of mitochondrial membrane potential	IDA	10983986
GO:0019901	Function	Protein kinase binding	IPI	10983986
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	10983986
GO:0032991	Component	Protein-containing complex	IMP	10983986
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IBA	21873635
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IMP	10983986
GO:0042802	Function	Identical protein binding	IDA	10983986
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0043066	Process	Negative regulation of apoptotic process	IDA	10983986
GO:0043539	Function	Protein serine/threonine kinase activator activity	IBA	21873635
GO:0043539	Function	Protein serine/threonine kinase activator activity	IMP	10983986
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	10983986
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IDA	10983986

Other IDs

• MIM: 186960
• HGNC: 11648
• e!Ensembl: ENSG00000100721

Protein

• UniProt ID: P56279
• Protein name: T-cell leukemia/lymphoma protein 1A (Oncogene TCL-1) (Oncogene TCL1) (Protein p14 TCL1)
• Protein function: Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3. Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival. {ECO:0000269|PubMed:10716693, ECO:00
• PDB: 1JSG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01840	TCL1_MTCP1	1 → 112	TCL1/MTCP1 family	Family

• Sequence:

  MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGR
  PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

• Sequence length: 114

Pathways

KEGG:

PI3K-Akt signaling pathway

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Lymphoblastic leukemia	Precursor T-Cell Lymphoblastic Leukemia-Lymphoma, Precursor T-cell acute lymphoblastic leukemia	rs387906351, rs104894562, rs398122513, rs398122840, rs398123063, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591