CLPTM1L (CLPTM1 like)

Gene

• Entrez ID: 81037
• Gene name: CLPTM1 like
• Gene symbol: CLPTM1L
• Synonyms: CRR9
• Chromosome: 5
• Chromosome location: 5p15.33
• Summary: The protein encoded by this gene is a membrane protein whose overexpression in cisplatin-sensitive cells causes apoptosis. Polymorphisms in this gene have been reported to increase susceptibility to several cancers, including lung, pancreatic, and breast

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050451	hsa-miR-22-3p	CLASH	23622248
MIRT723526	hsa-miR-4694-3p	HITS-CLIP	19536157
MIRT723527	hsa-miR-6856-3p	HITS-CLIP	19536157
MIRT723525	hsa-miR-3688-3p	HITS-CLIP	19536157
MIRT723524	hsa-miR-3622a-3p	HITS-CLIP	19536157
MIRT723523	hsa-miR-3622b-3p	HITS-CLIP	19536157
MIRT723522	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT723521	hsa-miR-5093	HITS-CLIP	19536157
MIRT723526	hsa-miR-4694-3p	HITS-CLIP	19536157
MIRT723527	hsa-miR-6856-3p	HITS-CLIP	19536157
MIRT723525	hsa-miR-3688-3p	HITS-CLIP	19536157
MIRT723524	hsa-miR-3622a-3p	HITS-CLIP	19536157
MIRT723523	hsa-miR-3622b-3p	HITS-CLIP	19536157
MIRT723522	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT723521	hsa-miR-5093	HITS-CLIP	19536157
MIRT897732	hsa-miR-1271	CLIP-seq
MIRT897733	hsa-miR-1290	CLIP-seq
MIRT897734	hsa-miR-182	CLIP-seq
MIRT897735	hsa-miR-4452	CLIP-seq
MIRT897736	hsa-miR-4671-5p	CLIP-seq
MIRT897737	hsa-miR-96	CLIP-seq
MIRT1966207	hsa-miR-105	CLIP-seq
MIRT897732	hsa-miR-1271	CLIP-seq
MIRT897733	hsa-miR-1290	CLIP-seq
MIRT897734	hsa-miR-182	CLIP-seq
MIRT1966208	hsa-miR-2115	CLIP-seq
MIRT1966209	hsa-miR-3689a-3p	CLIP-seq
MIRT1966210	hsa-miR-3689c	CLIP-seq
MIRT1966211	hsa-miR-377	CLIP-seq
MIRT1966212	hsa-miR-4251	CLIP-seq
MIRT1966213	hsa-miR-4267	CLIP-seq
MIRT1966214	hsa-miR-4329	CLIP-seq
MIRT1966215	hsa-miR-4447	CLIP-seq
MIRT1966216	hsa-miR-4472	CLIP-seq
MIRT1966217	hsa-miR-4488	CLIP-seq
MIRT897736	hsa-miR-4671-5p	CLIP-seq
MIRT1966218	hsa-miR-4677-3p	CLIP-seq
MIRT1966219	hsa-miR-4679	CLIP-seq
MIRT1966220	hsa-miR-4691-5p	CLIP-seq
MIRT1966221	hsa-miR-4697-5p	CLIP-seq
MIRT1966222	hsa-miR-516a-3p	CLIP-seq
MIRT1966223	hsa-miR-518e	CLIP-seq
MIRT1966224	hsa-miR-539	CLIP-seq
MIRT1966225	hsa-miR-634	CLIP-seq
MIRT1966226	hsa-miR-654-3p	CLIP-seq
MIRT897737	hsa-miR-96	CLIP-seq
MIRT1966207	hsa-miR-105	CLIP-seq
MIRT2202010	hsa-miR-1292	CLIP-seq
MIRT1966208	hsa-miR-2115	CLIP-seq
MIRT1966209	hsa-miR-3689a-3p	CLIP-seq
MIRT1966210	hsa-miR-3689c	CLIP-seq
MIRT2202011	hsa-miR-4471	CLIP-seq
MIRT1966220	hsa-miR-4691-5p	CLIP-seq
MIRT1966222	hsa-miR-516a-3p	CLIP-seq
MIRT1966224	hsa-miR-539	CLIP-seq
MIRT1966226	hsa-miR-654-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0006915	Process	Apoptotic process	IEA
GO:0012505	Component	Endomembrane system	IBA	21873635
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA	21873635
GO:0016021	Component	Integral component of membrane	IEA

Other IDs

• MIM: 612585
• HGNC: 24308
• e!Ensembl: ENSG00000049656

Protein

• UniProt ID: Q96KA5
• Protein name: Lipid scramblase CLPTM1L (Cisplatin resistance-related protein 9) (CRR9p) (Cleft lip and palate transmembrane protein 1-like protein) (CLPTM1-like protein)
• Protein function: Scramblase that mediates the translocation of glucosaminylphosphatidylinositol (alpha-D-GlcN-(1-6)-(1,2-diacyl-sn-glycero-3-phospho)-1D-myo-inositol, GlcN-PI) across the endoplasmic reticulum (ER) membrane, from the cytosolic leaflet to the lumi
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05602	CLPTM1	9 → 422	Cleft lip and palate transmembrane protein 1 (CLPTM1)	Family

• Sequence:

  MWSGRSSFTSLVVGVFVVYVVHTCWVMYGIVYTRPCSGDANCIQPYLARRPKLQLSVYTT
  TRSHLGAENNIDLVLNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHD
  GKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMA
  DNFVFDGSSLPADVHRYMKMIQLGKTVHYLPILFIDQLSNRVKDLMVINRSTTELPLTVS
  YDKVSLGRLRFWIHMQDAVYSLQQFGFSEKDADEVKGIFVDTNLYFLALTFFVAAFHLLF
  DFLAFKNDISFWKKKKSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVLVPAGVGAAIE
  LWKVKKALKMTIFWRGLMPEFQFGTYSESERKTEEYDTQAMKYLSYLLYPLCVGGAVYSL
  LNIKYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFTYKAFNTFIDD
  VFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVDKRRVNEFGESYEEKATRAPHTD

• Sequence length: 538

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Basal cell neoplasm	Basal Cell Neoplasm, Basal Cell Cancer	rs587776578, rs587776579, rs2117956624, rs2118419579, rs2118365442, rs2118041703, rs2136689212, rs2118336503, rs1587692888, rs267606984, rs878853849, rs1554695110, rs1064793921, rs1588605348, rs1588568813	25855136, 24403052, 27539887, 31174203, 19151717, 24403052, 31174203, 27539887, 19151717, 25855136
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243
Carcinoma	Basal cell carcinoma, Carcinoma, Basal Cell	rs121912654, rs555607708, rs786202962, rs1564055259	27539887, 25855136, 19151717, 31174203, 24403052, 24403052, 19151717
Cervical cancer	cervical cancer	rs28934571, rs121913482, rs121913483	19151717
Lung carcinoma	Non-Small Cell Lung Carcinoma, Squamous cell carcinoma of lung, Carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193	22675468, 31326317, 28604730, 31009812, 18978787, 28604730
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370, rs760043106, rs1057519788, rs1131692238, rs1131692237, rs1554350382	31326317, 31009812, 22675468, 19836008
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	19151717, 19654303, 24366883, 22899653, 18978787, 18978790
Melanoma	melanoma, Cutaneous Melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	21983787, 30429480
Nasopharyngeal carcinoma	Nasopharyngeal carcinoma	rs200046052	20512145
Pancreatic cancer	Malignant neoplasm of pancreas	rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431, rs200612497	20101243
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	19151717
Uveal melanoma	Uveal melanoma	rs1559588632	28781888

Unknown
Disease name	Disease term	dbSNP ID	References
Benign prostatic hyperplasia	Benign Prostatic Hyperplasia		30410027
Urinary bladder cancer	Malignant neoplasm of urinary bladder		20972438, 19151717, 24163127
Bladder neoplasm	Bladder Neoplasm		19151717
Bladder carcinoma	Carcinoma of bladder		20972438, 24163127
Uterine cervix neoplasm	Uterine Cervical Neoplasm		19151717
Lymphocytic leukemia	Chronic Lymphocytic Leukemia, Small Lymphocytic Lymphoma		24292274
Lung neoplasms	Lung Neoplasms		19151717, 24366883, 18978787
Lymphoid leukemia	Lymphoid leukemia		24292274
Malignant melanoma of skin	Malignant melanoma of skin of lower limb, Malignant melanoma of skin of upper limb	rs16891982	30429480
Malignant neoplasm of anterior portion of floor of mouth	Malignant neoplasm of anterior portion of floor of mouth		27749845
Malignant neoplasm of lip and oral cavity	Malignant neoplasm of other sites within the lip and oral cavity		27749845
Malignant neoplasm of mouth	Malignant neoplasm of other specified parts of mouth, Malignant neoplasm of mouth		27749845
Malignant testicular germ cell tumor	Malignant Testicular Germ Cell Tumor		20543847
Malignant tumor of lateral floor of mouth	Malignant neoplasm of lateral floor of mouth		27749845
Mouth neoplasms	Mouth Neoplasms		27749845
Malignant neoplasm of floor of mouth	Malignant neoplasm of floor of mouth		27749845
Nasopharyngeal neoplasms	Nasopharyngeal Neoplasms		26545403, 27436580
Pancreatic carcinoma	Pancreatic carcinoma		20101243, 29422604, 25086665, 26098869
Prostatic neoplasms	Prostatic Neoplasms		19151717