GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

WNT10A (Wnt family member 10A)

Gene

80326

Wnt family member 10A

WNT10A

ECTD16, OODD, SSPS, STHAG4

2q35

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Show/Hide all(26)

SNP ID	Visualize variation	Clinical significance	Consequence
rs34972707	A>C	Likely-benign, pathogenic, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs77583146	G>A	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, intron variant, missense variant
rs116998555	C>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign	Intron variant, coding sequence variant, missense variant
rs121908118	G>A,T	Pathogenic	Intron variant, stop gained, coding sequence variant, missense variant
rs121908120	T>A	Conflicting-interpretations-of-pathogenicity, benign, pathogenic, likely-benign	Intron variant, coding sequence variant, missense variant
rs121908121	G>A	Likely-pathogenic, not-provided, pathogenic	Intron variant, coding sequence variant, missense variant
rs121908122	C>A	Pathogenic	Stop gained, coding sequence variant, missense variant
rs146902156	G>A	Likely-benign, not-provided, pathogenic	Missense variant, coding sequence variant, intron variant
rs147680216	G>A	Likely-benign, pathogenic, benign, uncertain-significance	Missense variant, coding sequence variant, intron variant
rs372993798	G>A,T	Pathogenic, likely-pathogenic	Intron variant, coding sequence variant, missense variant
rs750260671	G>A,T	Likely-pathogenic	Coding sequence variant, stop gained, missense variant
rs762739726	C>T	Pathogenic, likely-pathogenic	Coding sequence variant, stop gained, intron variant
rs775380022	G>A	Likely-pathogenic	Missense variant, coding sequence variant, intron variant
rs775990266	G>-,GG	Pathogenic	Coding sequence variant, frameshift variant
rs886039453	C>T	Pathogenic	Stop gained, coding sequence variant, intron variant
rs886039454	C>G	Pathogenic	Stop gained, coding sequence variant, synonymous variant
rs886041618	->C	Pathogenic	Coding sequence variant, frameshift variant
rs1011303295	T>A,C	Pathogenic	Missense variant, coding sequence variant
rs1057520655	A>G	Pathogenic	Missense variant, coding sequence variant, intron variant
rs1060499588	C>T	Likely-pathogenic	Coding sequence variant, stop gained, intron variant
rs1085308031	G>A	Likely-pathogenic	Synonymous variant, missense variant, coding sequence variant
rs1268725013	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1553623281	AT>-	Pathogenic	Frameshift variant, coding sequence variant
rs1553623389	C>A	Pathogenic	Stop gained, coding sequence variant, missense variant
rs1575233692	C>-	Pathogenic	Frameshift variant, intron variant, coding sequence variant
rs1575235227	G>A	Pathogenic	Synonymous variant, coding sequence variant, missense variant

Show/Hide all(58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053636	hsa-miR-130a-3p	Microarray	22942087
MIRT533154	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT533153	hsa-miR-4690-3p	PAR-CLIP	22012620
MIRT533152	hsa-miR-5685	PAR-CLIP	22012620
MIRT533151	hsa-miR-361-3p	PAR-CLIP	22012620
MIRT533150	hsa-miR-4539	PAR-CLIP	22012620
MIRT533149	hsa-miR-1285-3p	PAR-CLIP	22012620
MIRT533148	hsa-miR-3187-5p	PAR-CLIP	22012620
MIRT533147	hsa-miR-5189-5p	PAR-CLIP	22012620
MIRT533146	hsa-miR-612	PAR-CLIP	22012620
MIRT533145	hsa-miR-6860	PAR-CLIP	22012620
MIRT533144	hsa-miR-4486	PAR-CLIP	22012620
MIRT533143	hsa-miR-378g	PAR-CLIP	22012620
MIRT533142	hsa-miR-3120-5p	PAR-CLIP	22012620
MIRT533141	hsa-miR-27a-5p	PAR-CLIP	22012620
MIRT533140	hsa-miR-203b-3p	PAR-CLIP	22012620
MIRT533139	hsa-miR-1231	PAR-CLIP	22012620
MIRT726098	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT726097	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT736197	hsa-miR-378a-3p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27832641
MIRT736197	hsa-miR-378a-3p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27832641
MIRT533151	hsa-miR-361-3p	HITS-CLIP	28735896
MIRT533153	hsa-miR-4690-3p	HITS-CLIP	28735896
MIRT533152	hsa-miR-5685	HITS-CLIP	28735896
MIRT736197	hsa-miR-378a-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	32829178
MIRT533151	hsa-miR-361-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33299350
MIRT533154	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT533153	hsa-miR-4690-3p	PAR-CLIP	22012620
MIRT533152	hsa-miR-5685	PAR-CLIP	22012620
MIRT533151	hsa-miR-361-3p	PAR-CLIP	22012620
MIRT533150	hsa-miR-4539	PAR-CLIP	22012620
MIRT533149	hsa-miR-1285-3p	PAR-CLIP	22012620
MIRT533148	hsa-miR-3187-5p	PAR-CLIP	22012620
MIRT533147	hsa-miR-5189-5p	PAR-CLIP	22012620
MIRT533146	hsa-miR-612	PAR-CLIP	22012620
MIRT533145	hsa-miR-6860	PAR-CLIP	22012620
MIRT533144	hsa-miR-4486	PAR-CLIP	22012620
MIRT533143	hsa-miR-378g	PAR-CLIP	22012620
MIRT533142	hsa-miR-3120-5p	PAR-CLIP	22012620
MIRT533141	hsa-miR-27a-5p	PAR-CLIP	22012620
MIRT533140	hsa-miR-203b-3p	PAR-CLIP	22012620
MIRT533139	hsa-miR-1231	PAR-CLIP	22012620
MIRT755397	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR	35958896
MIRT1493547	hsa-miR-2392	CLIP-seq
MIRT1493548	hsa-miR-4494	CLIP-seq
MIRT1493549	hsa-miR-4499	CLIP-seq
MIRT1493550	hsa-miR-4513	CLIP-seq
MIRT1493551	hsa-miR-451b	CLIP-seq
MIRT1493552	hsa-miR-4534	CLIP-seq
MIRT1493553	hsa-miR-4641	CLIP-seq
MIRT2148778	hsa-miR-3165	CLIP-seq
MIRT2148779	hsa-miR-3179	CLIP-seq
MIRT2148780	hsa-miR-4695-5p	CLIP-seq
MIRT2148781	hsa-miR-4790-3p	CLIP-seq
MIRT2148782	hsa-miR-765	CLIP-seq
MIRT2463526	hsa-miR-3183	CLIP-seq
MIRT2463527	hsa-miR-4723-3p	CLIP-seq
MIRT2463528	hsa-miR-500a	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001942	Process	Hair follicle development	IMP	17847007, 19559398
GO:0005109	Function	Frizzled binding	IBA	21873635
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0014033	Process	Neural crest cell differentiation	IEA
GO:0016055	Process	Wnt signaling pathway	TAS
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0031069	Process	Hair follicle morphogenesis	IMP	20163410
GO:0042476	Process	Odontogenesis	IMP	17847007, 19559398
GO:0042487	Process	Regulation of odontogenesis of dentin-containing tooth	IEA
GO:0043586	Process	Tongue development	IMP	17847007, 19559398
GO:0043588	Process	Skin development	IMP	17847007, 19559398
GO:0045165	Process	Cell fate commitment	IBA	21873635
GO:0048018	Function	Receptor ligand activity	IDA	28733458
GO:0048730	Process	Epidermis morphogenesis	IMP	20163410
GO:0048733	Process	Sebaceous gland development	IMP	19559398
GO:0060070	Process	Canonical Wnt signaling pathway	IBA	21873635
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	28733458
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEP	15040835

MIM	HGNC	e!Ensembl
606268	13829	ENSG00000135925

Protein

UniProt ID

Q9GZT5

Protein name

Protein Wnt-10a

Protein function

Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Functions in the canonical Wnt/beta-catenin signaling pathway (By similarity). Plays a role in normal ectoderm development (PubMed:17847007, PubMed:28589954).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	63 → 417	wnt family	Family

Sequence

MGSAHPRPWLRLRPQPQPRPALWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK

Sequence length

417

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		WNT ligand biogenesis and trafficking

Associated diseases

Show/Hide Causal Diseases (10)

Causal
Disease name	Disease term	dbSNP ID	References
Anonychia	ANONYCHIA	rs74315420, rs74315421, rs74315422, rs74315423, rs387907026, rs387907027, rs387907028, rs780261665, rs775644973, rs370554150
Carcinoma	Squamous cell carcinoma, Carcinoma, Basal Cell	rs121912654, rs555607708, rs786202962, rs1564055259
Ectodermal dysplasia	Ectodermal Dysplasia, Ectodermal Dysplasia, Hypohidrotic, Autosomal Recessive	rs74315309, rs121908116, rs1558814967, rs121908450, rs121908452, rs121908453, rs797044435, rs121908454, rs121908455, rs121908456, rs797044436, rs797044437, rs137853324, rs137853325, rs137853326, rs137853327, rs137853328, rs137853329, rs1569556603, rs2147483647, rs137853330, rs28933100, rs121913665, rs387907197, rs386134238, rs386134240, rs782540538, rs398122913, rs398122377, rs179363867, rs1565766888, rs747806672, rs879255553, rs886039564, rs886041005, rs766500689, rs886041411, rs782178147, rs1057519508, rs1057524917, rs139455627, rs1060499610, rs1553445945, rs1553448320, rs557166582, rs1569151872, rs1555916009, rs1566591076, rs1566591086, rs1566591082, rs1558814135, rs773885029, rs1590674994, rs1575653629, rs1575647025, rs781890406, rs749688157
Hypohidrotic ectodermal dysplasia	Anhydrotic Ectodermal Dysplasias, Autosomal recessive hypohidrotic ectodermal dysplasia	rs104894415, rs28937872, rs104894416
Hypotrichosis	Hypotrichosis	rs121434306, rs121434307, rs121434308, rs121434309, rs1325804776, rs267606775, rs786200875, rs1568062215, rs267606776, rs1462595806, rs267606777, rs267606659, rs2147483647, rs559648418, rs121917819, rs121917820, rs387906382, rs267606867, rs267606868, rs267606869, rs201868115, rs587776925, rs587777527, rs587777545, rs766783183, rs879255262, rs201249971, rs768448663, rs1566212378, rs1249530918, rs1260995701, rs1569039353, rs1827030121
Keratosis pilaris	Keratosis pilaris	rs483353013
Odontoonychodermal dysplasia	Odontoonychodermal dysplasia, Odonto-onycho-dermal dysplasia	rs121908118, rs121908119, rs121908121, rs121908122, rs121908123, rs886039453, rs750260671, rs543063101, rs764658964, rs1553623281, rs775990266, rs1553623389, rs1011303295, rs1575233692, rs1575235227	28981473, 19471313, 19559398, 21143469, 25545742, 24458874, 24702986, 20163410, 17847007, 24902757, 22670871, 20979233, 24398796, 23167694, 25629078, 28589954, 17847007, 24458874
Oligodontia	Oligodontia	rs1591901585	29364747
Palmoplantar keratoderma	Keratoderma, Palmoplantar	rs59616921, rs1568039793, rs746488412, rs200564757, rs1567027297, rs781596375, rs1567027610, rs398123054, rs398123055, rs398123056, rs398123057, rs398122949, rs398122950, rs397515639, rs398122951, rs397515640, rs397515641, rs142859678, rs797044479, rs577442939, rs672601344, rs568609861, rs1057518846, rs1182196436, rs1567037561
Tooth agenesis	TOOTH AGENESIS, SELECTIVE, 4 (disorder), Succedaneous Teeth, Agenesis Of, Tooth Agenesis, Selective, With Orofacial Cleft, Tooth Agenesis, Familial, TOOTH AGENESIS, SELECTIVE, 9	rs121908119, rs121908121, rs1881345182, rs104894467, rs28933970, rs2139108031, rs28933971, rs28933972, rs1594475481, rs2139106532, rs2139108874, rs121917720, rs121913129, rs104893852, rs104893850, rs121913130, rs1553877821, rs782540538, rs318240759, rs515726227, rs587776350, rs864309647, rs864309649, rs869320640, rs869320636, rs866789963, rs869320639, rs869320637, rs779326570, rs766021478, rs372993798, rs1057519288, rs1555316697, rs1131692057, rs1565611848, rs745522921, rs773036759	19471313, 25545742, 27657131, 28981473, 19559398, 24449199, 25629078, 24311251, 20979233, 22581971, 22670871, 24398796, 21143469, 29178643, 24702986, 20163410, 23167694, 24902757, 23401279, 21484994, 29364747

Show/Hide Unknown Diseases (25)

Unknown
Disease name	Disease term	dbSNP ID	References
Acne	Acne Vulgaris		30542056
Alopecia	Alopecia		28196072
Alopecia, male pattern	Alopecia, Male Pattern		27182965, 29146897
Androgenetic alopecia	Androgenetic Alopecia, Alopecia, Androgenetic, 3, Alopecia, Androgenetic, 2, Alopecia, Androgenetic, 1		29146897, 27182965, 27182965, 29146897
Anodontia	Developmental absence of tooth, Anodontia of Permanent Dentition		29364747
Apocrine adenoma	Apocrine adenoma
Apocrine cystadenoma	Apocrine cystadenoma
Dysmorphic features	Dysmorphic features		24043634, 24700731, 17847007, 19559398, 28105635, 25356970
Hyperhidrosis palmaris et plantaris	Hyperhidrosis Palmaris Et Plantaris
Hypodontia	Hypodontia		29364747
Hypodontia oligodontia with orofacial cleft	Hypodontia Oligodontia with Orofacial Cleft		29364747
Hypohidrosis	Hypohidrosis
Hypoplasia of teeth	Hypoplasia of teeth
Hypoplasia of the maxilla	Hypoplasia of the maxilla
Malignant lymphoma, lymphocytic, intermediate differentiation	Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse		18787224
Lymphoma, lymphocytic, intermediate	Lymphoma, Lymphocytic, Intermediate		18787224
Microdontia	Microdontia (disorder)
Micrognathism	Micrognathism
Nail diseases	NAIL DISORDER, NONSYNDROMIC CONGENITAL, 9
Nail dysplasia	Nail dysplasia
Onycholysis	Onycholysis
Ovarian neoplasm	ovarian neoplasm
Poroma	Poroma
Schopf-schulz-passarge syndrome	SCHOPF-SCHULZ-PASSARGE SYNDROME (disorder), Sch�pf-Schulz-Passarge syndrome		24398796, 21143469, 25629078, 19559398, 24702986, 24902757, 23167694
Tooth development and eruption disorder	Tooth development and eruption disorder		29364747

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412