MLLT10 (MLLT10 histone lysine methyltransferase DOT1L cofactor)
|
Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
8028 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
MLLT10 histone lysine methyltransferase DOT1L cofactor |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
MLLT10 |
SynonymsGene synonyms aliases
|
AF10 |
ChromosomeChromosome number
|
10 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
10p12.31 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
This gene encodes a transcription factor and has been identified as a partner gene involved in several chromosomal rearrangements resulting in various leukemias. Multiple transcript variants encoding different isoforms have been found for this gene. [prov |
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
P55197 |
Protein name |
Protein AF-10 (ALL1-fused gene from chromosome 10 protein) |
Protein function |
Probably involved in transcriptional regulation. In vitro or as fusion protein with KMT2A/MLL1 has transactivation activity. Binds to cruciform DNA. In cells, binding to unmodified histone H3 regulates DOT1L functions including histone H3 'Lys-7 |
PDB |
5DAG
,
5DAH
,
6CKN
,
6CKO
,
6JN2
,
7MJU
|
Family and domains |
Pfam
Accession |
ID |
Position in sequence |
Description |
Type |
PF13831 |
PHD_2 |
36 → 72 |
|
Family |
PF13832 |
zf-HC5HC2H_2 |
80 → 197 |
|
Domain |
|
Sequence |
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQ VPTGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTM EPIVLQSVPHDRYNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSYDQSLSDSSSHSQDKHHEKEKKKYKEKDK HKQKHKKQPEPSPALVPSLTVTTEKTYTSTSNNSISGSLKRLEDTTARFTNANFQEVSAH TSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGL PSTSAVTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEEETVKEKKRKGNKQSKHGPGR PKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS EISMQYRHDGACPTTTFSELLNAIHNGIYNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQS SGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMYGNRSNSSMAALIAQSEN NQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRYDQPGNSSLENLPPVAASIEQLL ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSV PFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQS TSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLL SDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLYQLMQHHHQQHHQPELQQLQIPGPTQIP INNLLAGTQAPPLHTATTNPFLTIHGDNASQKVARLSDKTGPVAQEKS
|
|
Sequence length |
1068 |
Interactions |
View interactions |
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Breast carcinoma |
Breast Carcinoma |
rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451, rs397507859, rs80359709, rs80359742, rs80359205, rs80357627, rs80357004, rs80357571, rs80357767, rs80357653, rs80358086, rs80357608, rs28897696, rs41293465, rs146650273, rs63751017, rs63750617, rs63750726, rs63750199, rs63749848, rs398122618, rs398122653, rs397509211, rs80357791, rs121912666, rs587778541, rs121908698, rs536907995, rs587781302, rs140342925, rs587781506, rs587782652, rs587782849, rs587783057, rs10520699, rs11852999, rs139770721, rs374950566, rs786202800, rs863224451, rs377153250, rs747727055, rs876658804, rs780001540, rs760815829, rs878854926, rs775248597, rs886040658, rs886040192, rs786203523, rs886040319, rs397508006, rs587782011, rs1060502772, rs1555461727, rs1553333072, rs1114167702, rs1257401983, rs886040950, rs1060502759, rs774684620, rs142947311, rs1555580883, rs748513310, rs376170600, rs863224499, rs1593909229, rs748453607, rs1294578913, rs1574737047, rs1593909960, rs2081922847, rs2082559544, rs2053694038 |
29059683 |
Leukemia |
Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2) |
rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601 |
|
Lymphoblastic leukemia |
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma, Precursor T-cell acute lymphoblastic leukemia |
rs387906351, rs104894562, rs398122513, rs398122840, rs398123063, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591 |
23673860 |
Melanoma |
melanoma |
rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050 |
22535842 |
Meningioma |
Meningioma, Meningiomas, Multiple, Clear Cell Meningioma |
rs587776563, rs121434259, rs387906857, rs397509405, rs397509406, rs397509407, rs397509408, rs797045990, rs876659443, rs878854603, rs1057518166, rs1060501395, rs1554897280, rs1554898242, rs1555605347, rs587782187, rs1555605750, rs878853937, rs1589596143, rs2037146593, rs2037146907 |
21804547 |
Ovarian cancer |
Epithelial ovarian cancer, Malignant neoplasm of ovary |
rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828, rs80357208, rs55770810, rs80358165, rs80358010, rs587780226, rs536907995, rs139414606, rs371638537, rs574552037, rs730881647, rs747993448, rs786202125, rs786202962, rs121913321, rs189261858, rs869320800, rs753023295, rs779466229, rs752411477, rs80357438, rs191486604, rs760874290, rs752780954, rs760782298, rs1555591361, rs1555578360, rs1555588460, rs1555587401, rs747427602, rs112675807, rs80357393 |
25581431, 23535730 |
Papillary renal carcinoma |
Papillary Renal Cell Carcinoma |
rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724 |
23797736 |
Renal carcinoma |
Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney |
rs121913668, rs121913670, rs121913243, rs786202724 |
23797736 |
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Angioblastic meningioma |
Angioblastic Meningioma |
|
21804547 |
Angiomatous meningioma |
Angiomatous Meningioma |
|
21804547 |
Benign meningioma |
Benign Meningioma |
|
21804547 |
Cerebral convexity meningioma |
Cerebral Convexity Meningioma |
|
21804547 |
Chromophobe carcinoma |
Chromophobe Renal Cell Carcinoma |
rs137853247 |
23797736 |
Fibrous meningioma |
Fibrous Meningioma |
|
21804547 |
Fossa meningioma |
Posterior Fossa Meningioma |
|
21804547 |
Hemangioblastic meningioma |
Hemangioblastic Meningioma |
|
21804547 |
Hemangiopericytic meningioma |
Hemangiopericytic Meningioma |
|
21804547 |
Intracranial meningioma |
Intracranial Meningioma |
|
21804547 |
Intraorbital meningioma |
Intraorbital Meningioma |
|
21804547 |
Intraventricular meningioma |
Intraventricular Meningioma |
|
21804547 |
Malignant meningioma |
Malignant Meningioma |
|
21804547 |
Meningothelial meningioma |
Meningothelial meningioma |
|
21804547 |
Microcystic meningioma |
Microcystic meningioma |
rs779101828 |
21804547 |
Myeloid leukemia |
Acute Myeloid Leukemia, M1 |
|
|
Olfactory groove meningioma |
Olfactory Groove Meningioma |
|
21804547 |
Ovarian neoplasm |
ovarian neoplasm |
|
28346442, 23535730 |
Ovarian serous adenocarcinoma |
Ovarian Serous Adenocarcinoma |
|
28346442 |
Papillary meningioma |
Papillary Meningioma |
|
21804547 |
Parasagittal meningioma |
Parasagittal Meningioma |
|
21804547 |
Psammomatous meningioma |
Psammomatous Meningioma |
|
21804547 |
Secretory meningioma |
Secretory meningioma |
|
21804547 |
Sphenoid wing meningioma |
Sphenoid Wing Meningioma |
|
21804547 |
Spinal meningioma |
Spinal Meningioma |
|
21804547 |
Transitional meningioma |
Transitional Meningioma |
|
21804547 |
Xanthomatous meningioma |
Xanthomatous Meningioma |
|
21804547 |
|
|
|