KDM8 (lysine demethylase 8)

Gene

• Entrez ID: 79831
• Gene name: Lysine demethylase 8
• Gene symbol: KDM8
• Synonyms: JMJD5
• Chromosome: 16
• Chromosome location: 16p12.1
• Summary: This gene likely encodes a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045429	hsa-miR-149-5p	CLASH	23622248
MIRT052832	hsa-miR-378c	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	IMP	20457893
GO:0003682	Function	Chromatin binding	IDA	20457893
GO:0004175	Function	Endopeptidase activity	IDA	28847961
GO:0004177	Function	Aminopeptidase activity	IDA	28847961
GO:0005515	Function	Protein binding	IPI	24981860
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	20457893
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006508	Process	Proteolysis	IEA
GO:0016706	Function	2-oxoglutarate-dependent dioxygenase activity	IBA	21873635
GO:0031648	Process	Protein destabilization	IMP	30500822
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0035064	Function	Methylated histone binding	IDA	28847961
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IMP	30500822
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	20457893
GO:0046872	Function	Metal ion binding	IEA
GO:0051864	Function	Histone demethylase activity (H3-K36 specific)	IBA	21873635
GO:0051864	Function	Histone demethylase activity (H3-K36 specific)	IDA	20457893
GO:0070544	Process	Histone H3-K36 demethylation	IBA	21873635
GO:0070544	Process	Histone H3-K36 demethylation	IDA	20457893
GO:0140554	Function	L-arginine 3-hydroxylase activity	IDA	29563586

Other IDs

• MIM: 611917
• HGNC: 25840
• e!Ensembl: ENSG00000155666

Protein

• UniProt ID: Q8N371
• Protein name: Bifunctional peptidase and arginyl-hydroxylase JMJD5 (EC 1.14.11.73) (EC 3.4.-.-) (JmjC domain-containing protein 5) (Jumonji C domain-containing protein 5) (L-arginine (3R)-hydroxylase KDM8)
• Protein function: Bifunctional enzyme that acts both as an endopeptidase and 2-oxoglutarate-dependent monooxygenase (PubMed:28847961, PubMed:28982940, PubMed:29459673, PubMed:29563586). Endopeptidase that cleaves histones N-terminal tails at the carboxyl side of
• PDB: 3UYJ, 4AAP, 4GAZ, 4GJY, 4GJZ, 4QU1, 5FBJ, 6AVS, 6AX3, 6F4M, 6F4N, 6F4O, 6F4P, 6F4Q, 6F4R, 6F4S, 6F4T, 6I9L, 6I9M, 6I9N, 7DYT, 7DYU, 7DYV, 7DYW, 7DYX, 7UQ3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13621	Cupin_8	192 → 416	Cupin-like domain	Domain

• Sequence:

  MAGDTHCPAEPLAREGTLWEALRALLPHSKEDLKLDLGEKVERSVVTLLQRATELFYEGR
  RDECLQSSEVILDYSWEKLNTGTWQDVDKDWRRVYAIGCLLKALCLCQAPEDANTVAAAL
  RVCDMGLLMGAAILGDILLKVAAILQTHLPGKRPARGSLPEQPCTKKARADHGLIPDVKL
  EKTVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVG
  SRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDG
  EEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNT
  SQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS

• Sequence length: 416

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		28284560