GediPNet logo

TTC21B (tetratricopeptide repeat domain 21B)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79809
Gene nameGene Name - the full gene name approved by the HGNC.
Tetratricopeptide repeat domain 21B
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TTC21B
SynonymsGene synonyms aliases
ATD4, CFAP60, FAP60, FLA17, IFT139, IFT139B, JBTS11, NPHP12, Nbla10696, SRTD4, THM1
ChromosomeChromosome number
2
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q24.3
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of TTC21 family, containing several tetratricopeptide repeat (TPR) domains. This protein is localized to the cilium axoneme, and may play a role in retrograde intraflagellar transport in cilia. Mutations in this gene are associa
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs76726265 C>T Conflicting-interpretations-of-pathogenicity, likely-benign Coding sequence variant, missense variant
rs79746977 G>A Pathogenic Coding sequence variant, stop gained
rs139441507 G>A Conflicting-interpretations-of-pathogenicity, uncertain-significance, benign-likely-benign Coding sequence variant, missense variant
rs140384742 G>A Conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, coding sequence variant, missense variant, 3 prime UTR variant
rs146320075 T>C Conflicting-interpretations-of-pathogenicity, uncertain-significance Missense variant, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT046982 hsa-miR-218-5p CLASH 23622248
MIRT696584 hsa-miR-3974 HITS-CLIP 23313552
MIRT696583 hsa-miR-624-3p HITS-CLIP 23313552
MIRT696582 hsa-miR-6808-5p HITS-CLIP 23313552
MIRT696581 hsa-miR-6893-5p HITS-CLIP 23313552
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
GO:0005929 Component Cilium TAS
GO:0006357 Process Regulation of transcription by RNA polymerase II IMP 22302990
GO:0030991 Component Intraciliary transport particle A IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q7Z4L5
Protein name Tetratricopeptide repeat protein 21B (TPR repeat protein 21B) (Intraflagellar transport 139 homolog)
Protein function Component of the IFT complex A (IFT-A), a complex required for retrograde ciliary transport and entry into cilia of G protein-coupled receptors (GPCRs). Essential for retrograde trafficking of IFT-1, IFT-B and GPCRs (PubMed:27932497). Negatively
PDB 8BBE , 8BBG , 8FGW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13181 TPR_8
722 755
Tetratricopeptide repeat
Repeat
PF13181 TPR_8
790 822
Tetratricopeptide repeat
Repeat
PF14559 TPR_19
894 961
Domain
Sequence
MDSQELKTLINYYCQERYFHHVLLVASEGIKRYGSDPVFRFYHAYGTLMEGKTQEALREF
EAIKNKQDVSLCSLLALIYAHKMSPNPDREAILESDARVKEQRKGAGEKALYHAGLFLWH
IGRHDKAREYIDRMIKISDGSKQGHVLKAWLDITRGKEPYTKKALKYFEEGLQDGNDTFA
LLGKAQCLEMRQNYSGALETVNQIIVNFPSFLPAFVKKMKLQLALQDWDQTVETAQRLLL
QDSQNVEALRMQALYYVCREGDIEKASTKLENLGNTLDAMEPQNAQLFYNITLAFSRTCG
RSQLILQKIQTLLERAFSLNPQQSEFATELGYQMILQGRVKEALKWYKTAMTLDETSVSA
LVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLN
DVLDTHFSQLEGLPLGIQYFEKLNPDFLLEIVMEYLSFCPMQPASPGQPLCPLLRRCISV
LETVVRTVPGLLQTVFLIAKVKYLSGDIEAAFNNLQHCLEHNPSYADAHLLLAQVYLSQE
KVKLCSQSLELCLSYDFKVRDYPLYHLIKAQSQKKMGEIADAIKTLHMAMSLPGMKRIGA
STKSKDRKTEVDTSHRLSIFLELIDVHRLNGEQHEATKVLQDAIHEFSGTSEEVRVTIAN
ADLALAQGDIERALSILQNVTAEQPYFIEAREKMADIYLKHRKDKMLYITCFREIAERMA
NPRSFLLLGDAYMNILEPEEAIVAYEQALNQNPKDGTLASKMGKALIKTHNYSMAITYYE
AALKTGQKNYLCYDLAELLLKLKWYDKAEKVLQHALAHEPVNELSALMEDGRCQVLLAKV
YSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDY
EKAIKFYREALVHCETDNKIMLELARLYLAQDDPDSCLRQCALLLQSDQDNEAATMMMAD
L
MFRKQDYEQAVFHLQQLLERKPDNYMTLSRLIDLLRRCGKLEDVPRFFSMAEKRNSRAK
LEPGFQYCKGLYLWYTGEPNDALRHFNKARKDRDWGQNALYNMIEICLNPDNETVGGEVF
ENLDGDLGNSTEKQESVQLAVRTAEKLLKELKPQTVQGHVQLRIMENYCLMATKQKSNVE
QALNTFTEIAASEKEHIPALLGMATAYMILKQTPRARNQLKRIAKMNWNAIDAEEFEKSW
LLLADIYIQSAKYDMAEDLLKRCLRHNRSCCKAYEYMGYIMEKEQAYTDAALNYEMAWKY
SNRTNPAVGYKLAFNYLKAKRYVDSIDICHQVLEAHPTYPKIRKDILDKARASLRP
Sequence length 1316
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    Hedgehog 'off' state
Intraflagellar transport
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Asphyxiating thoracic dystrophy Saldino-Noonan Syndrome, Asphyxiating Thoracic Dystrophy 1 rs137853115, rs137853025, rs1565310938, rs137853028, rs137853029, rs137853030, rs137853031, rs137853032, rs431905499, rs137853033, rs137853034, rs137853035, rs431905500, rs483352907, rs387906980, rs387906982, rs185089786, rs387907060, rs397514637, rs431905507, rs138004478, rs786205645, rs794727944, rs780539887, rs201948500, rs769975073, rs374356079, rs879255656, rs879255655, rs864622358, rs200460601, rs755883373, rs754919042, rs886039815, rs886039812, rs758522600, rs886039795, rs201037487, rs771487311, rs1043384862, rs562139820, rs771003300, rs552436294, rs943680446, rs431905497, rs368631447, rs759086770, rs775836730, rs1456300819, rs1554478948, rs1554770620, rs1554771066, rs555339053, rs896105030, rs755305630, rs771511132, rs762873763, rs764769351, rs369614706, rs371011047, rs748906528, rs1555042801, rs1555043520, rs373335226, rs1555051720, rs745870321, rs1555052524, rs901629870, rs1555054771, rs1461272672, rs780855765, rs1555060411, rs1243999036, rs1555060940, rs1555061228, rs747348765, rs1322884865, rs1555062340, rs1555063811, rs537704873, rs1386343205, rs762588952, rs1350329646, rs1555064376, rs1555066796, rs200614421, rs964711006, rs1196317554, rs747857715, rs1214801816, rs371940321, rs1555068270, rs1555071484, rs1555071503, rs776407305, rs373924400, rs1555077194, rs780600124, rs1261505725, rs200710887, rs181011657, rs1555082470, rs1453448143, rs369658526, rs766816050, rs756811136, rs368654019, rs1223907858, rs759549373, rs760214276, rs1565317399, rs1565329461, rs767846762, rs1565359085, rs751891969, rs1565390180, rs1384888093, rs1565394086, rs1565438488, rs561778796, rs373536938, rs767206815, rs371932985, rs372878677, rs1577822861, rs1327583103, rs1862810311 21258341
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852, rs121917853, rs121917854, rs121917855, rs121917859, rs121917861, rs267606873, rs267606872, rs267606985, rs267606986, rs267606987, rs267606988, rs28933082, rs397514519, rs869025613, rs869025614, rs886039878, rs1553540620, rs1057518333, rs1948841937, rs1948868228, rs1948842030, rs1948842142
Finnish congenital nephrotic syndrome Finnish congenital nephrotic syndrome rs28939378, rs137853042, rs267606919, rs267606917, rs17107315, rs140511594, rs386833863, rs386833864, rs386833865, rs386833866, rs386833867, rs386833869, rs386833871, rs386833870, rs386833872, rs386833874, rs386833873, rs386833875, rs386833876, rs386833877, rs386833878, rs386833880, rs386833881, rs386833882, rs386833883, rs386833884, rs386833885, rs386833886, rs386833887, rs386833888, rs386833889, rs386833890, rs386833891, rs386833892, rs386833893, rs386833894, rs386833895, rs386833897, rs386833898, rs386833899, rs191807913, rs386833900, rs386833901, rs386833902, rs386833903, rs386833904, rs386833905, rs386833906, rs386833907, rs386833908, rs386833909, rs386833910, rs386833911, rs114203578, rs386833912, rs386833913, rs386833914, rs386833915, rs386833916, rs386833917, rs386833918, rs386833919, rs386833920, rs386833921, rs386833922, rs386833923, rs386833924, rs386833925, rs386833926, rs386833927, rs386833928, rs386833929, rs386833930, rs386833931, rs386833932, rs386833935, rs386833937, rs386833938, rs386833939, rs386833940, rs386833941, rs386833942, rs386833943, rs386833944, rs386833945, rs386833946, rs386833947, rs386833948, rs386833949, rs386833950, rs386833951, rs386833952, rs386833953, rs386833954, rs386833955, rs1555763603, rs386833957, rs386833958, rs386833959, rs386833961, rs386833962, rs730880176, rs730880174, rs530318579, rs150855173, rs786204729, rs138656762, rs150038620, rs139598219, rs1057516637, rs748819031, rs369410355, rs751809997, rs755763002, rs1057517022, rs1057517021, rs1057516918, rs1057516776, rs1057517413, rs781584590, rs778217926, rs1057517275, rs1054950770, rs1057516942, rs1057524695, rs1131692245, rs1555761997, rs1555763372, rs749341977, rs762392183, rs1555758163, rs767887213, rs756436580, rs758432802, rs34124941, rs1555762381, rs1244884053, rs763972372, rs1555763503, rs1555764281, rs750714387, rs771953692, rs1555763974, rs1430464721, rs1555758856, rs1009762900, rs762184939, rs778951863, rs1555762591, rs1555763090, rs1555763460, rs772979927, rs767832658, rs140018064, rs1315968443, rs1579327590, rs1599835856, rs1599845714, rs1420307327, rs1599845689, rs1972879328, rs1161720919, rs1973176439
Jeune thoracic dystrophy Jeune thoracic dystrophy rs137853025, rs137853028, rs137853030, rs137853031, rs137853032, rs431905500, rs201188361, rs587776909, rs397514637, rs431905507, rs199952377, rs431905521, rs587777352, rs750396637, rs755338872, rs794727595, rs776315442, rs780539887, rs864622358, rs864622111, rs200460601, rs755883373, rs878852996, rs754919042, rs770185023, rs201858128, rs771487311, rs773858865, rs1043384862, rs562139820, rs771003300, rs754049402, rs552436294, rs943680446, rs746068882, rs368631447, rs1202784860, rs1236962991, rs1453462442, rs1553316926, rs776631281, rs764906529, rs1553753582, rs372576954, rs1553905326, rs748656635, rs377160857, rs1215108056, rs772599282, rs1191056931, rs745603321, rs1553815019, rs1553836165, rs761707323, rs1554770453, rs1554771175, rs555811074, rs755305630, rs771511132, rs762873763, rs764769351, rs369614706, rs371011047, rs748906528, rs1555042801, rs1555043520, rs373335226, rs1555049536, rs1555051720, rs745870321, rs1555052511, rs1555052524, rs1555053115, rs901629870, rs762666243, rs1555056464, rs1380132788, rs1555057838, rs753662982, rs747348765, rs1555063811, rs537704873, rs1350329646, rs758155107, rs1196317554, rs747857715, rs969015057, rs1555068270, rs1555068636, rs1555070451, rs1555071484, rs1555071503, rs776407305, rs373924400, rs1218198013, rs780600124, rs1261505725, rs200710887, rs1555081345, rs181011657, rs759649136, rs1555098222, rs1453448143, rs766816050, rs368654019, rs1555052497, rs1223907858, rs759549373, rs1555096711, rs200335504, rs1555038664, rs747165335, rs1565311145, rs1565317399, rs1260978141, rs1565329461, rs767846762, rs376892534, rs1566883760, rs1309577378, rs1565423740, rs1565371538, rs1565359085, rs1159774355, rs1291197898, rs751891969, rs1565390180, rs1558104145, rs1401798992, rs561778796, rs1266078341, rs1565368793, rs373536938, rs765454943, rs1160036887, rs767206815, rs372878677 21258341, 24876116, 22791528
Unknown
Disease name Disease term dbSNP ID References
Ciliopathies Ciliopathies
Congenital hepatic fibrosis Hepatic Fibrosis, Congenital 26940125, 24876116
Disorder of eye Disorder of eye
Dwarfism Dwarfism

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412