CARF (calcium responsive transcription factor)

Gene

• Entrez ID: 79800
• Gene name: Calcium responsive transcription factor
• Gene symbol: CARF
• Synonyms: ALS2CR8, NYD-SP24
• Chromosome: 2
• Chromosome location: 2q33.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025457	hsa-miR-34a-5p	Proteomics	21566225
MIRT043277	hsa-miR-331-3p	CLASH	23622248
MIRT503813	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT503813	hsa-miR-1277-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT503813	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT503813	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT503814	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT503814	hsa-miR-190a-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT503814	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT503814	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT503815	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT503815	hsa-miR-5011-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT503815	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT503815	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT503816	hsa-miR-521	PAR-CLIP	23446348
MIRT503816	hsa-miR-521	PAR-CLIP, HITS-CLIP	21572407
MIRT503816	hsa-miR-521	PAR-CLIP	20371350
MIRT503816	hsa-miR-521	HITS-CLIP	23824327
MIRT515275	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT515275	hsa-miR-495-5p	PAR-CLIP	21572407
MIRT550292	hsa-miR-153-5p	PAR-CLIP	21572407
MIRT550292	hsa-miR-153-5p	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001652	Component	Granular component	IEA
GO:0003677	Function	DNA binding	IDA	11832226
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11832226
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0035865	Process	Cellular response to potassium ion	IDA	22174809
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	IEA
GO:0061400	Process	Positive regulation of transcription from RNA polymerase II promoter in response to calcium ion	IDA	11832226, 22174809
GO:0071277	Process	Cellular response to calcium ion	IDA	11832226, 22174809

Other IDs

• MIM: 607586
• HGNC: 14435
• e!Ensembl: ENSG00000138380

Protein

• UniProt ID: Q8N187
• Protein name: Calcium-responsive transcription factor (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8 protein) (Calcium-response factor) (CaRF) (Testis development protein NYD-SP24)
• Protein function: Acts as a transcriptional activator that mediates the calcium- and neuron-selective induction of BDNF exon III transcription. Binds to the consensus calcium-response element CaRE1 5'-CTATTTCGAG-3' sequence.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15299	ALS2CR8	253 → 483	Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8	Family

• Sequence:

  MEQSNDSLRVNHNDGEESKTSAQVFEHLICMDSRDSSFGQNDSPTVLPITTREANNSLIS
  QNIPGPLTQTQTLSAEQFHLVDQNGQAIQYELQSLGESNAQMMIVASPTENGQVLRVIPP
  TQTGMAQVIIPQGQLVDVNSPRDVPEEKPSNRNLPTVRVDTLADNTSNYILHPQTSFPLP
  KKSVTGMLEEPLLGPLQPLSSNTPIWACRLRSCEKIGDSYRGYCVSETELESVLTFHKQQ
  TQSVWGTRQSPSPAKPATRLMWKSQYVPYDGIPFVNAGSRAVVMECQYGPRRKGFQLKKV
  SEQESRSCQLYKATCPARIYIKKVQKFPEYRVPTDPKIDKKIIRMEQEKAFNMLKKNLVD
  AGGVLRWYVQLPTQQAHQYHELETPCLTLSPSPFPVSSLEEEETAVRDENCALPSRLHPQ
  VAHKIQELVSQGIEQVYAVRKQLRKFVERELFKPDEVPERHNLSFFPTVNDIKNHIHEVQ
  KSLRNGDTVYNSEIIPATLQWTTDSGNILKETMTVTFAEGNSPGESITTKVETNQTRGSL
  SPEPTHLLSSLSSFQPKIFTQLQGLQLQPRYTSPDESPAVVSVNNQPSSSPSGLLDTIGS
  AVMNNNSLLLGQSHSLQRDTCLTQNNSTASTMGNLPEPDQNLVAMDELVEVGDVEDTGNL
  EGTVHRILLGDVQTIPIQIIDNHSALIEENPESTISVSQVKQEPKEPALSMEAKKTVDYK
  KLSAT

• Sequence length: 725

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs-1, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	31164008
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	28714975
Migraine	Migraine Disorders	rs794727411	27182965, 27322543

Unknown
Disease name	Disease term	dbSNP ID	References
Mental depression	Major Depressive Disorder	rs587778876, rs587778877	31164008
Bipolar disorder	Bipolar Disorder		31164008