CENPU (centromere protein U)

Gene

• Entrez ID: 79682
• Gene name: Centromere protein U
• Gene symbol: CENPU
• Synonyms: CENP50, CENPU50, KLIP1, MLF1IP, PBIP1
• Chromosome: 4
• Chromosome location: 4q35.1
• Summary: The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT737060	hsa-miR-495-3p	Western blotting, qRT-PCR	33902008

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000777	Component	Condensed chromosome kinetochore	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0016032	Process	Viral process	IEA
GO:0034080	Process	CENP-A containing nucleosome assembly	TAS
GO:0034451	Component	Centriolar satellite	IDA
GO:0043009	Process	Chordate embryonic development	IEA

Other IDs

• MIM: 611511
• HGNC: 21348
• e!Ensembl: ENSG00000151725

Protein

• UniProt ID: Q71F23
• Protein name: Centromere protein U (CENP-U) (Centromere protein of 50 kDa) (CENP-50) (Interphase centromere complex protein 24) (KSHV latent nuclear antigen-interacting protein 1) (MLF1-interacting protein) (Polo-box-interacting protein 1)
• Protein function: Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal)
• PDB: 7PB8, 7PKN, 7QOO, 7R5S, 7R5V, 7XHN, 7XHO, 7YWX, 7YYH, 8K4D
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13097	CENP-U	144 → 320	CENP-A nucleosome associated complex (NAC) subunit	Family

• Sequence:

  MAPRGRRRPRPHRSEGARRSKNTLERTHSMKDKAGQKCKPIDVFDFPDNSDVSSIGRLGE
  NEKDEETYETFDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIES
  VKISAKKPGRKLRPISDDSESIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAES
  VTSKKTGPLSAQPSVEKENLAIESQSKTQKKGKISHDKRKKSRSKAIGSDTSDIVHIWCP
  EGMKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIATFYVNVKEQFIKMLKESQMLT
  NLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSSLRNAAYFLSN
  LKQLYQDYSDVQAQEPNVKETYDSSSLPALLFKARTLLGAESHLRNINHQLEKLLDQG

• Sequence length: 418

Pathways

Reactome:

Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Deposition of new CENPA-containing nucleosomes at the centromere
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Kawasaki disease	Mucocutaneous Lymph Node Syndrome		22446962
Liver carcinoma	Liver carcinoma		28284560
Lupus erythematosus	Lupus Erythematosus, Systemic		19838195