GediPNet logo

BCL2L14 (BCL2 like 14)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79370
Gene nameGene Name - the full gene name approved by the HGNC.
BCL2 like 14
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
BCL2L14
SynonymsGene synonyms aliases
BCLG
ChromosomeChromosome number
12
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.2
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has be
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT450423 hsa-miR-3663-5p PAR-CLIP 22100165
MIRT450422 hsa-miR-4677-3p PAR-CLIP 22100165
MIRT450421 hsa-miR-4679 PAR-CLIP 22100165
MIRT450420 hsa-miR-4635 PAR-CLIP 22100165
MIRT450419 hsa-miR-570-3p PAR-CLIP 22100165
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 11054413, 17280616, 30833792, 32296183
GO:0005829 Component Cytosol IDA 11054413
GO:0005829 Component Cytosol TAS
GO:0006915 Process Apoptotic process IDA 17280616
GO:0012505 Component Endomembrane system IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9BZR8
Protein name Apoptosis facilitator Bcl-2-like protein 14 (Bcl2-L-14) (Apoptosis regulator Bcl-G)
Protein function Plays a role in apoptosis.
Family and domains
Sequence
MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGN
CSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTL
EYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEI
FVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDG
LSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKY
LKENFSPWIQQHGGWEKILGISHEEVD
Sequence length 327
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Coronary artery disease CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT 2 (disorder) rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537
Tooth agenesis TOOTH AGENESIS, SELECTIVE, 7 rs121908119, rs121908121, rs1881345182, rs104894467, rs28933970, rs2139108031, rs28933971, rs28933972, rs1594475481, rs2139106532, rs2139108874, rs121917720, rs121913129, rs104893852, rs104893850, rs121913130, rs1553877821, rs782540538, rs318240759, rs515726227, rs587776350, rs864309647, rs864309649, rs869320640, rs869320636, rs866789963, rs869320639, rs869320637, rs779326570, rs766021478, rs372993798, rs1057519288, rs1555316697, rs1131692057, rs1565611848, rs745522921, rs773036759
Unknown
Disease name Disease term dbSNP ID References
Clinodactyly Clinodactyly

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412