FSD1 (fibronectin type III and SPRY domain containing 1)

Gene

• Entrez ID: 79187
• Gene name: Fibronectin type III and SPRY domain containing 1
• Gene symbol: FSD1
• Synonyms: GLFND, MIR1
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: This gene encodes a centrosome associated protein that is characterized by an N-terminal coiled-coil region downstream of B-box (BBC) domain, a central fibronectin type III domain, and a C-terminal repeats in splA and RyR (SPRY) domain. The encoded protei

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1005441	hsa-miR-3150a-3p	CLIP-seq
MIRT1005442	hsa-miR-3175	CLIP-seq
MIRT1005443	hsa-miR-4258	CLIP-seq
MIRT1005444	hsa-miR-4707-3p	CLIP-seq
MIRT1005445	hsa-miR-491-5p	CLIP-seq
MIRT1005446	hsa-miR-939	CLIP-seq
MIRT1997985	hsa-miR-15a	CLIP-seq
MIRT1997986	hsa-miR-15b	CLIP-seq
MIRT1997987	hsa-miR-16	CLIP-seq
MIRT1997988	hsa-miR-195	CLIP-seq
MIRT1997989	hsa-miR-424	CLIP-seq
MIRT1997990	hsa-miR-497	CLIP-seq
MIRT2535473	hsa-miR-1254	CLIP-seq
MIRT2535474	hsa-miR-149	CLIP-seq
MIRT2535475	hsa-miR-3116	CLIP-seq
MIRT2535476	hsa-miR-4779	CLIP-seq
MIRT2535477	hsa-miR-542-3p	CLIP-seq
MIRT2535478	hsa-miR-550a	CLIP-seq
MIRT2535479	hsa-miR-661	CLIP-seq
MIRT2535480	hsa-miR-766	CLIP-seq
MIRT2535473	hsa-miR-1254	CLIP-seq
MIRT2535474	hsa-miR-149	CLIP-seq
MIRT2535475	hsa-miR-3116	CLIP-seq
MIRT2535476	hsa-miR-4779	CLIP-seq
MIRT2535477	hsa-miR-542-3p	CLIP-seq
MIRT2535478	hsa-miR-550a	CLIP-seq
MIRT2535479	hsa-miR-661	CLIP-seq
MIRT2535480	hsa-miR-766	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IMP	12154070
GO:0005874	Component	Microtubule	IMP	12154070, 12445389
GO:0007049	Process	Cell cycle	IEA
GO:0008017	Function	Microtubule binding	IMP	12154070
GO:0031122	Process	Cytoplasmic microtubule organization	IMP	12154070, 12445389
GO:0032154	Component	Cleavage furrow	IEA
GO:0032465	Process	Regulation of cytokinesis	IDA	12445389
GO:0042802	Function	Identical protein binding	IPI	12154070
GO:0051301	Process	Cell division	IEA
GO:0051302	Process	Regulation of cell division	IDA	12445389
GO:0060236	Process	Regulation of mitotic spindle organization	IDA	12154070

Other IDs

• MIM: 609828
• HGNC: 13745
• e!Ensembl: ENSG00000105255

Protein

• UniProt ID: Q9BTV5
• Protein name: Fibronectin type III and SPRY domain-containing protein 1 (MID1-related protein 1) (Microtubule-associated protein GLFND)
• Protein function: May be involved in microtubule organization and stabilization.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00041	fn3	167 → 258	Fibronectin type III domain	Domain
  PF00622	SPRY	355 → 473	SPRY domain	Family

• Sequence:

  MEEQREALRKIIKTLAVKNEEIQSFIYSLKQMLLNVEANSAKVQEDLEAEFQSLFSLLEE
  LKEGMLMKIKQDRASRTYELQNQLAACTRALESSEELLETANQTLQAMDSEDFPQAAKQI
  KDGVTMAPAFRLSLKAKVSDNMSHLMVDFAQERQMLQALKFLPVPSAPVIDLAESLVADN
  CVTLVWRMPDEDSKIDHYVLEYRRTNFEGPPRLKEDQPWMVIEGIRQTEYTLTGLKFDMK
  YMNFRVKACNKAVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDI
  KAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAESYTVLGDTLIDGGEHYWEV
  RYEPDSKAFGVGVAYRSLGRFEQLGKTAASWCLHVNNWLQVSFTAKHANKVKVLDAPVPD
  CLGVHCDFHQGLLSFYNARTKQVLHTFKTRFTQPLLPAFTVWCGSFQVTTGLQVPSAVRC
  LQKRGSATSSSNTSLT

• Sequence length: 496

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	16367923

Unknown
Disease name	Disease term	dbSNP ID	References
Stomach neoplasms	Malignant neoplasm of stomach, Stomach Neoplasms		16367923