BAG6 (BAG cochaperone 6)

Gene

• Entrez ID: 7917
• Gene name: BAG cochaperone 6
• Gene symbol: BAG6
• Synonyms: BAG-6, BAT3, D6S52E, G3
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: This gene was first characterized as part of a cluster of genes located within the human major histocompatibility complex class III region. This gene encodes a nuclear protein that is cleaved by caspase 3 and is implicated in the control of apoptosis. In

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025262	hsa-miR-34a-5p	Proteomics	21566225
MIRT025262	hsa-miR-34a-5p	Proteomics	21566225
MIRT031479	hsa-miR-16-5p	Proteomics	18668040
MIRT051911	hsa-let-7b-5p	CLASH	23622248
MIRT049283	hsa-miR-92a-3p	CLASH	23622248
MIRT046630	hsa-miR-222-3p	CLASH	23622248
MIRT043997	hsa-miR-378a-5p	CLASH	23622248
MIRT043466	hsa-miR-331-3p	CLASH	23622248
MIRT041655	hsa-miR-484	CLASH	23622248
MIRT041655	hsa-miR-484	CLASH	23622248
MIRT041258	hsa-miR-193b-3p	CLASH	23622248
MIRT041258	hsa-miR-193b-3p	CLASH	23622248
MIRT040645	hsa-miR-92b-3p	CLASH	23622248
MIRT039860	hsa-miR-615-3p	CLASH	23622248
MIRT039860	hsa-miR-615-3p	CLASH	23622248
MIRT037504	hsa-miR-744-5p	CLASH	23622248
MIRT037504	hsa-miR-744-5p	CLASH	23622248
MIRT036783	hsa-miR-760	CLASH	23622248
MIRT036531	hsa-miR-1226-3p	CLASH	23622248
MIRT441129	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441129	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT2179906	hsa-miR-1252	CLIP-seq
MIRT2179907	hsa-miR-200b	CLIP-seq
MIRT2179908	hsa-miR-200c	CLIP-seq
MIRT2179909	hsa-miR-3611	CLIP-seq
MIRT2179910	hsa-miR-429	CLIP-seq
MIRT2179911	hsa-miR-4318	CLIP-seq
MIRT2179912	hsa-miR-4693-5p	CLIP-seq
MIRT2179913	hsa-miR-553	CLIP-seq
MIRT2179914	hsa-miR-625	CLIP-seq
MIRT2179915	hsa-miR-892a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001822	Process	Kidney development	ISS
GO:0002429	Process	Immune response-activating cell surface receptor signaling pathway	IDA	18852879
GO:0005102	Function	Signaling receptor binding	IPI	18852879
GO:0005515	Function	Protein binding	IPI	14667819, 14960581, 16189514, 17403783, 18765639, 18852879, 21903422, 22046132, 22807449, 23246001, 25036637, 25416956, 25535373, 25713138, 26496610, 26876100, 27113755, 29042515, 31515488
GO:0005634	Component	Nucleus	IDA	14960581, 17403783, 21636303, 29042515
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	21636303
GO:0005829	Component	Cytosol	IDA	17403783, 20676083, 23246001, 29042515
GO:0006325	Process	Chromatin organization	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	ISS
GO:0006915	Process	Apoptotic process	IDA	14960581
GO:0007130	Process	Synaptonemal complex assembly	ISS
GO:0007283	Process	Spermatogenesis	ISS
GO:0007420	Process	Brain development	ISS
GO:0010498	Process	Proteasomal protein catabolic process	IMP	26565908
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	23246001
GO:0018393	Process	Internal peptidyl-lysine acetylation	IDA	17403783
GO:0030101	Process	Natural killer cell activation	IDA	18852879
GO:0030154	Process	Cell differentiation	IEA
GO:0030324	Process	Lung development	ISS
GO:0030433	Process	Ubiquitin-dependent ERAD pathway	IBA	21873635
GO:0030433	Process	Ubiquitin-dependent ERAD pathway	IDA	23129660, 24981174
GO:0030433	Process	Ubiquitin-dependent ERAD pathway	IMP	26565908
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	IBA	21873635
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	21636303, 24981174
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	17403783
GO:0043022	Function	Ribosome binding	IDA	20676083
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0045861	Process	Negative regulation of proteolysis	ISS
GO:0045995	Process	Regulation of embryonic development	ISS
GO:0050821	Process	Protein stabilization	ISS
GO:0051787	Function	Misfolded protein binding	IBA	21873635
GO:0051787	Function	Misfolded protein binding	IDA	21636303
GO:0061857	Process	Endoplasmic reticulum stress-induced pre-emptive quality control	IMP	26565908
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	ISS
GO:0070062	Component	Extracellular exosome	IDA	18852879
GO:0070628	Function	Proteasome binding	ISS
GO:0071712	Process	ER-associated misfolded protein catabolic process	IDA	23129660, 24981174
GO:0071816	Process	Tail-anchored membrane protein insertion into ER membrane	IDA	20676083, 25535373
GO:0071818	Component	BAT3 complex	IBA	21873635
GO:0071818	Component	BAT3 complex	IDA	20676083, 21636303, 25535373
GO:1904294	Process	Positive regulation of ERAD pathway	IMP	24424410
GO:1904378	Process	Maintenance of unfolded protein involved in ERAD pathway	IMP	21636303
GO:1904379	Process	Protein localization to cytosolic proteasome complex involved in ERAD pathway	NAS	21636303
GO:1990381	Function	Ubiquitin-specific protease binding	IPI	24424410

Other IDs

• MIM: 142590
• HGNC: 13919
• e!Ensembl: ENSG00000204463

Protein

• UniProt ID: P46379
• Protein name: Large proline-rich protein BAG6 (BAG family molecular chaperone regulator 6) (BCL2-associated athanogene 6) (BAG-6) (HLA-B-associated transcript 3) (Protein G3) (Protein Scythe)
• Protein function: ATP-independent molecular chaperone preventing the aggregation of misfolded and hydrophobic patches-containing proteins (PubMed:21636303). Functions as part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, which maintains t
• PDB: 1WX9, 2N9P, 4DWF, 4EEW, 4WWR, 4X86, 6AU8, 7RU9, 7RUA, 7RUC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00240	ubiquitin	19 → 89	Ubiquitin family	Domain
  PF12057	BAG6	276 → 392	BCL2-associated athanogene 6	Domain

• Sequence:

  MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
  YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGP
  GASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLL
  SRMETLPYLQCRGGPQPQHSQPPPQPPAVTPEPVALSSQTSEPVESEAPPREPMEAEEVE
  ERAPAQNPELTPGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEV
  LGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACTPPRHLHVVRP
  MSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNV
  ESSAEGAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLG
  PPGHGQTLGQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQM
  VSGLVGQLLMQPVLVAQGTPGMAPPPAPATASASAGTTNTATTAGPAPGGPAQPPPTPQP
  SMADLQFSQLLGNLLGPAGPGAGGSGVASPTITVAMPGVPAFLQGMTDFLQATQTAPPPP
  PPPPPPPPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEFFTSVVQGVLSSLLGSLGARA
  GSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQPLQR
  LQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLE
  FLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIR
  RMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGA
  ERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVP
  IIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLT
  SPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQRAFADDP

• Sequence length: 1132

Pathways

KEGG:

Protein export

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	17632545
Hypertension	Hypertensive disease	rs13306026, rs13333226	21909115
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544	17660530, 20598377
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	17804836, 21156761, 19503088

Unknown
Disease name	Disease term	dbSNP ID	References
Hodgkin disease	Hodgkin Disease		24149102
Lupus erythematosus	Lupus Erythematosus, Systemic		24871463
Psoriatic arthritis	Arthritis, Psoriatic		30552173