CARD14 (caspase recruitment domain family member 14)
|
Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
79092 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Caspase recruitment domain family member 14 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
CARD14 |
SynonymsGene synonyms aliases
|
BIMP2, CARMA2, PRP, PSORS2, PSS1 |
ChromosomeChromosome number
|
17 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
17q25.3 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
This gene encodes a caspase recruitment domain-containing protein that is a member of the membrane-associated guanylate kinase (MAGUK) family of proteins. Members of this protein family are scaffold proteins that are involved in a diverse array of cellula |
SNPsSNP information provided by dbSNP.
|
SNP ID |
Visualize variation |
Clinical significance |
Consequence |
rs200790561 |
G>A |
Conflicting-interpretations-of-pathogenicity |
Non coding transcript variant, genic upstream transcript variant, coding sequence variant, missense variant |
rs281875212 |
G>A,C |
Not-provided, pathogenic |
Non coding transcript variant, genic upstream transcript variant, coding sequence variant, missense variant |
rs281875213 |
A>G |
Not-provided, pathogenic |
Non coding transcript variant, genic upstream transcript variant, coding sequence variant, missense variant |
rs281875214 |
A>C |
Not-provided, pathogenic |
Non coding transcript variant, genic upstream transcript variant, coding sequence variant, missense variant |
rs281875215 |
G>A |
Not-provided, pathogenic |
Non coding transcript variant, genic upstream transcript variant, coding sequence variant, missense variant |
rs369755459 |
T>G |
Likely-pathogenic |
Non coding transcript variant, stop gained, coding sequence variant, 5 prime UTR variant |
rs387907240 |
T>C |
Pathogenic |
Non coding transcript variant, genic upstream transcript variant, coding sequence variant, missense variant |
rs587777763 |
G>A,C |
Pathogenic |
Intron variant, genic upstream transcript variant |
rs886041402 |
G>A |
Pathogenic |
Genic upstream transcript variant, splice donor variant |
rs1567872320 |
G>A |
Pathogenic |
Missense variant, coding sequence variant, non coding transcript variant, genic upstream transcript variant |
rs1598639584 |
T>C,G |
Uncertain-significance, pathogenic |
Missense variant, coding sequence variant, non coding transcript variant, genic upstream transcript variant |
rs1598639617 |
T>C |
Pathogenic |
Missense variant, coding sequence variant, non coding transcript variant, genic upstream transcript variant |
rs1598639659 |
G>C |
Pathogenic |
Missense variant, coding sequence variant, non coding transcript variant, genic upstream transcript variant |
rs1598639974 |
A>C |
Pathogenic |
Missense variant, coding sequence variant, non coding transcript variant, genic upstream transcript variant |
|
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q9BXL6 |
Protein name |
Caspase recruitment domain-containing protein 14 (CARD-containing MAGUK protein 2) (Carma 2) |
Protein function |
Acts as a scaffolding protein that can activate the inflammatory transcription factor NF-kappa-B and p38/JNK MAP kinase signaling pathways. Forms a signaling complex with BCL10 and MALT1, and activates MALT1 proteolytic activity and inflammatory |
Family and domains |
Pfam
Accession |
ID |
Position in sequence |
Description |
Type |
PF00619 |
CARD |
20 → 106 |
Caspase recruitment domain |
Domain |
|
Sequence |
MGELCRRDSALTALDEETLWEMMESHRHRIVRCICPSRLTPYLRQAKVLCQLDEEEVLHS PRLTNSAMRAGHLLDLLKTRGKNGAIAFLESLKFHNPDVYTLVTGLQPDVDFSNFSGLME TSKLTECLAGAIGSLQEELNQEKGQKEVLLRRCQQLQEHLGLAETRAEGLHQLEADHSRM KREVSAHFHEVLRLKDEMLSLSLHYSNALQEKELAASRCRSLQEELYLLKQELQRANMVS SCELELQEQSLRTASDQESGDEELNRLKEENEKLRSLTFSLAEKDILEQSLDEARGSRQE LVERIHSLRERAVAAERQREQYWEEKEQTLLQFQKSKMACQLYREKVNALQAQVCELQKE RDQAYSARDSAQREISQSLVEKDSLRRQVFELTDQVCELRTQLRQLQAEPPGVLKQEART REPCPREKQRLVRMHAICPRDDSDCSLVSSTESQLLSDLSATSSRELVDSFRSSSPAPPS QQSLYKRVAEDFGEEPWSFSSCLEIPEGDPGALPGAKAGDPHLDYELLDTADLPQLESSL QPVSPGRLDVSESGVLMRRRPARRILSQVTMLAFQGDALLEQISVIGGNLTGIFIHRVTP GSAADQMALRPGTQIVMVDYEASEPLFKAVLEDTTLEEAVGLLRRVDGFCCLSVKVNTDG YKRLLQDLEAKVATSGDSFYIRVNLAMEGRAKGELQVHCNEVLHVTDTMFQGCGCWHAHR VNSYTMKDTAAHGTIPNYSRAQQQLIALIQDMTQQCTVTRKPSSGGPQKLVRIVSMDKAK ASPLRLSFDRGQLDPSRMEGSSTCFWAESCLTLVPYTLVRPHRPARPRPVLLVPRAVGKI LSEKLCLLQGFKKCLAEYLSQEEYEAWSQRGDIIQEGEVSGGRCWVTRHAVESLMEKNTH ALLDVQLDSVCTLHRMDIFPIVIHVSVNEKMAKKLKKGLQRLGTSEEQLLEAARQEEGDL DRAPCLYSSLAPDGWSDLDGLLSCVRQAIADEQKKVVWTEQSPR
|
|
Sequence length |
1004 |
Interactions |
View interactions |
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
|
|
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Autoinflammatory disease |
Autoinflammatory disorder |
rs777759523, rs121434352, rs28940578, rs28940580, rs121908146, rs121908148, rs121908150, rs80338807, rs121908679, rs104895319, rs104894176, rs28933973, rs28933376, rs137854447, rs61736587, rs148755083, rs104895093, rs104895311, rs104895364, rs104895352, rs104895271, rs104895238, rs151344629, rs180177431, rs376785840, rs587777241, rs77563738, rs202134424, rs864321625, rs864321682, rs864321626, rs864321684, rs864321685, rs869312838, rs869312953, rs766657895, rs140148806, rs753966933, rs764196809, rs200956636, rs147035858, rs1274685768, rs1600700389, rs1776278098, rs754904956, rs1760720617, rs1760720924 |
29980436 |
Ichthyosis |
Ichthyoses |
rs199766569, rs587776996, rs587777262, rs863223405, rs370031870, rs1569044747, rs200806519 |
|
Moyamoya disease |
Moyamoya Disease, Moyamoya disease 1 |
rs121434527, rs121434528, rs387906592, rs397514563, rs797045187, rs1555675538, rs1568149971, rs1599150380, rs2079443410 |
29273593 |
Palmoplantar keratoderma |
Keratoderma, Palmoplantar |
rs59616921, rs1568039793, rs746488412, rs200564757, rs1567027297, rs781596375, rs1567027610, rs398123054, rs398123055, rs398123056, rs398123057, rs398122949, rs398122950, rs397515639, rs398122951, rs397515640, rs397515641, rs142859678, rs797044479, rs577442939, rs672601344, rs568609861, rs1057518846, rs1182196436, rs1567037561 |
|
Psoriasis |
Psoriasis, PSORIASIS 2 |
rs281875215, rs587777763, rs281875213, rs281875212 |
29980436, 23143594, 24212883, 27113748, 22521419, 22521418, 29980436, 29689250, 27071417, 26358359 |
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Eczema |
Eczema |
|
|
Exfoliative dermatitis |
Exfoliative dermatitis |
|
|
Hyperkeratosis |
Hyperkeratosis |
|
|
Neoplasms |
Neoplasms |
|
|
Palmoplantar pustules |
Pustulosis of Palms and Soles |
|
24212883, 23143594 |
Parakeratosis |
Parakeratosis |
|
|
Psoriasiform eczema |
Psoriasiform eczema |
|
|
Subungual hyperkeratosis |
Subungual hyperkeratosis |
|
|
|
|
|