GediPNet logo

GID4 (GID complex subunit 4 homolog)
Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79018
Gene nameGene Name - the full gene name approved by the HGNC.
GID complex subunit 4 homolog
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
GID4
SynonymsGene synonyms aliases
C17orf39, VID2, VID24
ChromosomeChromosome number
17
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p11.2|17p11.2
SummarySummary of gene provided in NCBI Entrez Gene.
The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located wit
miRNAmiRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
miRTarBase ID miRNA Experiments Reference
MIRT016107 hsa-miR-421 Sequencing 20371350
MIRT029028 hsa-miR-26b-5p Microarray 19088304
MIRT030790 hsa-miR-21-5p Microarray 18591254
MIRT039248 hsa-miR-454-3p CLASH 23622248
MIRT612973 hsa-miR-183-5p HITS-CLIP 19536157
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IDA 29911972
GO:0016567 Process Protein ubiquitination IEA
GO:0043161 Process Proteasome-mediated ubiquitin-dependent protein catabolic process IBA 21873635
GO:0061630 Function Ubiquitin protein ligase activity IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8IVV7
Protein name Glucose-induced degradation protein 4 homolog (Vacuolar import and degradation protein 24 homolog)
Protein function Substrate-recognition subunit of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1 (Probable) (PubMed:29
PDB 6CCR , 6CCT , 6CCU , 6CD8 , 6CD9 , 6CDC , 6CDG , 6WZX , 6WZZ , 7NSC , 7Q4Y , 7Q50 , 7SLZ , 7U3E , 7U3F , 7U3G , 7U3H , 7U3I , 7U3J , 7U3K , 7U3L , 8V1P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09783 Vac_ImportDeg
121 → 289
Vacuolar import and degradation protein
 Family
Sequence 
MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATL
LGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATS
LLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEII
SKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFL
VPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR
Sequence length 300
Interactions View interactions
Associated diseases
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Causal
Disease name Disease term dbSNP ID References
Schizophrenia Schizophrenia rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313 25056061, 31268507, 28991256, 26198764, 30285260

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412