GediPNet logo

SLBP (stem-loop histone mRNA binding protein)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7884
Gene nameGene Name - the full gene name approved by the HGNC.
Stem-loop histone mRNA binding protein
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
SLBP
SynonymsGene synonyms aliases
HBP
ChromosomeChromosome number
4
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p16.3
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023573 hsa-miR-1-3p Microarray 18668037
MIRT029110 hsa-miR-26b-5p Microarray 19088304
MIRT609764 hsa-miR-8485 HITS-CLIP 23824327
MIRT609763 hsa-miR-329-3p HITS-CLIP 23824327
MIRT609762 hsa-miR-362-3p HITS-CLIP 23824327
Transcription factors
Transcription factor Regulation Reference
UPF1 Unknown 25016523
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674
GO:0003729 Function MRNA binding IBA 21873635
GO:0003729 Function MRNA binding IDA 16912046
GO:0005515 Function Protein binding IPI 15829567, 16086026, 18172165, 23286197, 23329046, 23804756
GO:0005634 Component Nucleus IDA 15829567
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q14493
Protein name Histone RNA hairpin-binding protein (Histone stem-loop-binding protein)
Protein function RNA-binding protein involved in the histone pre-mRNA processing (PubMed:12588979, PubMed:19155325, PubMed:8957003, PubMed:9049306). Binds the stem-loop structure of replication-dependent histone pre-mRNAs and contributes to efficient 3'-end proc
PDB 2KJM , 4L8R , 4QOZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15247 SLBP_RNA_bind
130 199
Histone RNA hairpin-binding protein RNA-binding domain
Family
Sequence
MACRPRSPPRHQSRCDGDASPPSPARWSLGRKRRADGRRWRPEDAEEAEHRGAERRPESF
TTPEGPKPRSRCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKES
MSTVPADFETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSR
RSWDQQIKLWKVALHFWDP
PAEEGCDLQEIHPVDLESAESSSEPQTSSQDDFDVYSGTPT
KVRHMDSQVEDEFDLEACLTEPLRDFSAMS
Sequence length 270
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    Transport of the SLBP Dependant Mature mRNA
RNA Polymerase II Transcription Termination
SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Congenital ocular coloboma Congenital ocular coloboma (disorder) rs587778875, rs587777249, rs767611891, rs2091986259, rs2091987023, rs2091988799 30695021
Optic atrophy Optic Atrophy rs121434508, rs267607017, rs80356524, rs80356525, rs879255560, rs104893753, rs80356529, rs397515360, rs104893620, rs199476104, rs199476112, rs199476118, rs398124298, rs770066665, rs398124299, rs61750185, rs672601379, rs727504060, rs786204830, rs794727804, rs199946797, rs863224127, rs863224131, rs863224134, rs863224906, rs372054380, rs886037828, rs764791523, rs145639028, rs1057519312, rs1064794257, rs1064794656, rs1064797303, rs774265764, rs760337383, rs1553784985, rs72653786, rs1555229948, rs1555119216, rs761743852, rs1553785338, rs1020764190, rs782581701, rs1560408865, rs761460379, rs773022324, rs782740998, rs1560327427, rs80356528, rs1734162973, rs1716524583, rs1057368575 30695021
Unknown
Disease name Disease term dbSNP ID References
Knee osteoarthritis Osteoarthritis, Knee 30664745
Osteoarthritis of hip Osteoarthritis of hip 30664745
Retinal dysplasia Retinal Dysplasia 30695021
Uveoretinal coloboma Uveoretinal Coloboma 30695021

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412