KCNAB1 (potassium voltage-gated channel subfamily A regulatory beta subunit 1)

Gene

• Entrez ID: 7881
• Gene name: Potassium voltage-gated channel subfamily A regulatory beta subunit 1
• Gene symbol: KCNAB1
• Synonyms: AKR6A3, KCNA1B, KV-BETA-1, Kvb1.3, hKvBeta3, hKvb3
• Chromosome: 3
• Chromosome location: 3q25.31
• Summary: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, e

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT447061	hsa-miR-4282	PAR-CLIP	22100165
MIRT447062	hsa-miR-3606-3p	PAR-CLIP	22100165
MIRT447060	hsa-miR-513a-3p	PAR-CLIP	22100165
MIRT447059	hsa-miR-513c-3p	PAR-CLIP	22100165
MIRT447058	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT447057	hsa-miR-144-5p	PAR-CLIP	22100165
MIRT447056	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447055	hsa-miR-578	PAR-CLIP	22100165
MIRT447061	hsa-miR-4282	PAR-CLIP	22100165
MIRT447062	hsa-miR-3606-3p	PAR-CLIP	22100165
MIRT447060	hsa-miR-513a-3p	PAR-CLIP	22100165
MIRT447059	hsa-miR-513c-3p	PAR-CLIP	22100165
MIRT447058	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT447057	hsa-miR-144-5p	PAR-CLIP	22100165
MIRT447056	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447055	hsa-miR-578	PAR-CLIP	22100165
MIRT1080347	hsa-miR-1246	CLIP-seq
MIRT1080348	hsa-miR-1290	CLIP-seq
MIRT1080349	hsa-miR-2052	CLIP-seq
MIRT1080350	hsa-miR-3121-3p	CLIP-seq
MIRT1080351	hsa-miR-3167	CLIP-seq
MIRT1080352	hsa-miR-323b-5p	CLIP-seq
MIRT1080353	hsa-miR-450b-5p	CLIP-seq
MIRT1080354	hsa-miR-876-5p	CLIP-seq
MIRT1080355	hsa-miR-216b	CLIP-seq
MIRT740133	hsa-miR-3140-3p	CLIP-seq
MIRT740134	hsa-miR-3143	CLIP-seq
MIRT1080356	hsa-miR-3613-5p	CLIP-seq
MIRT1080357	hsa-miR-3922-5p	CLIP-seq
MIRT1080358	hsa-miR-4260	CLIP-seq
MIRT1080359	hsa-miR-4699-3p	CLIP-seq
MIRT1080360	hsa-miR-4753-5p	CLIP-seq
MIRT740135	hsa-miR-543	CLIP-seq
MIRT1080361	hsa-miR-548c-3p	CLIP-seq
MIRT1080362	hsa-miR-624	CLIP-seq
MIRT1080363	hsa-miR-635	CLIP-seq
MIRT2019977	hsa-miR-3686	CLIP-seq
MIRT2019978	hsa-miR-4652-3p	CLIP-seq
MIRT2555089	hsa-miR-1207-3p	CLIP-seq
MIRT2555090	hsa-miR-129-3p	CLIP-seq
MIRT2555091	hsa-miR-3183	CLIP-seq
MIRT2555092	hsa-miR-320a	CLIP-seq
MIRT2555093	hsa-miR-320b	CLIP-seq
MIRT2555094	hsa-miR-320c	CLIP-seq
MIRT2555095	hsa-miR-320d	CLIP-seq
MIRT2555096	hsa-miR-3671	CLIP-seq
MIRT2555097	hsa-miR-4429	CLIP-seq
MIRT2555098	hsa-miR-4687-5p	CLIP-seq
MIRT2555099	hsa-miR-4723-3p	CLIP-seq
MIRT2555100	hsa-miR-4753-3p	CLIP-seq
MIRT2555089	hsa-miR-1207-3p	CLIP-seq
MIRT2555090	hsa-miR-129-3p	CLIP-seq
MIRT2555091	hsa-miR-3183	CLIP-seq
MIRT2555092	hsa-miR-320a	CLIP-seq
MIRT2555093	hsa-miR-320b	CLIP-seq
MIRT2555094	hsa-miR-320c	CLIP-seq
MIRT2555095	hsa-miR-320d	CLIP-seq
MIRT2555096	hsa-miR-3671	CLIP-seq
MIRT2555097	hsa-miR-4429	CLIP-seq
MIRT2555098	hsa-miR-4687-5p	CLIP-seq
MIRT2555099	hsa-miR-4723-3p	CLIP-seq
MIRT2555100	hsa-miR-4753-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004033	Function	Aldo-keto reductase (NADP) activity	IBA	21873635
GO:0004033	Function	Aldo-keto reductase (NADP) activity	ISS
GO:0005249	Function	Voltage-gated potassium channel activity	IEA
GO:0005829	Component	Cytosol	IDA	17540341
GO:0005886	Component	Plasma membrane	TAS
GO:0006813	Process	Potassium ion transport	TAS	7499366
GO:0007420	Process	Brain development	IEA
GO:0007507	Process	Heart development	IEA
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	IBA	21873635
GO:0008076	Component	Voltage-gated potassium channel complex	IMP	10585425
GO:0015459	Function	Potassium channel regulator activity	IBA	21873635
GO:0015459	Function	Potassium channel regulator activity	IDA	7890032, 12130714
GO:0019904	Function	Protein domain specific binding	IPI	10585425
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IBA	21873635
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IDA	17540341
GO:0032839	Component	Dendrite cytoplasm	IEA
GO:0034705	Component	Potassium channel complex	IDA	12130714
GO:0043204	Component	Perikaryon	IEA
GO:0044224	Component	Juxtaparanode region of axon	IBA	21873635
GO:0044325	Function	Ion channel binding	IBA	21873635
GO:0045445	Process	Myoblast differentiation	IEA
GO:0060539	Process	Diaphragm development	IEA
GO:0070402	Function	NADPH binding	IDA	17540341
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IBA	21873635
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IDA	7890032
GO:1902259	Process	Regulation of delayed rectifier potassium channel activity	ISS
GO:1902260	Process	Negative regulation of delayed rectifier potassium channel activity	IBA	21873635
GO:1903817	Process	Negative regulation of voltage-gated potassium channel activity	IMP	10585425
GO:1990635	Component	Proximal dendrite	IEA

Other IDs

• MIM: 601141
• HGNC: 6228
• e!Ensembl: ENSG00000169282

Protein

• UniProt ID: Q14722
• Protein name: Voltage-gated potassium channel subunit beta-1 (EC 1.1.1.-) (K(+) channel subunit beta-1) (Kv-beta-1)
• Protein function: Regulatory subunit of the voltage-gated potassium (Kv) Shaker channels composed of pore-forming and potassium-conducting alpha subunits and of regulatory beta subunits (PubMed:17156368, PubMed:17540341, PubMed:19713757, PubMed:7499366, PubMed:76
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00248	Aldo_ket_red	103 → 408	Aldo/keto reductase family	Domain

• Sequence:

  MLAARTGAAGSQISEENTKLRRQSGFSVAGKDKSPKKASENAKDSSLSPSGESQLRARQL
  ALLREVEMNWYLKLCDLSSEHTTVCTTGMPHRNLGKSGLRVSCLGLGTWVTFGGQISDEV
  AERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETE
  RGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTS
  RWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLAC
  GIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV
  AWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS

• Sequence length: 419

Pathways

Reactome:

Voltage gated Potassium channels

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	26708285
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	27903959