GediPNet logo

ZIC2 (Zic family zinc finger 2)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7546
Gene nameGene Name - the full gene name approved by the HGNC.
Zic family zinc finger 2
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
ZIC2
SynonymsGene synonyms aliases
HPE5
ChromosomeChromosome number
13
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q32.3
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This protein functions as a transcriptional repressor and may regulate tissue specific expression of dopamine receptor D1. Expansion of an alanine repeat in the C-terminus of
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs397515364 ->C Pathogenic Coding sequence variant, frameshift variant
rs397515365 GAGAACC>- Pathogenic Coding sequence variant, frameshift variant
rs397515499 G>- Pathogenic Coding sequence variant, frameshift variant
rs397515500 AG>- Pathogenic Coding sequence variant, frameshift variant
rs753776168 C>G,T Pathogenic Stop gained, missense variant, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT048739 hsa-miR-93-5p CLASH 23622248
MIRT044573 hsa-miR-320a CLASH 23622248
MIRT618798 hsa-miR-548ae-3p HITS-CLIP 23824327
MIRT618797 hsa-miR-548ah-3p HITS-CLIP 23824327
MIRT618796 hsa-miR-548aj-3p HITS-CLIP 23824327
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0003677 Function DNA binding ISS
GO:0003700 Function DNA-binding transcription factor activity ISS
GO:0005634 Component Nucleus IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID O95409
Protein name Zinc finger protein ZIC 2 (Zinc finger protein of the cerebellum 2)
Protein function Acts as a transcriptional activator or repressor. Plays important roles in the early stage of organogenesis of the CNS. Activates the transcription of the serotonin transporter SERT in uncrossed ipsilateral retinal ganglion cells (iRGCs) to refi
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18366 zf_ZIC
248 295
Zic proteins zinc finger domain
Domain
PF00096 zf-C2H2
333 357
Zinc finger, C2H2 type
Domain
PF00096 zf-C2H2
363 387
Zinc finger, C2H2 type
Domain
PF00096 zf-C2H2
393 415
Zinc finger, C2H2 type
Domain
Sequence
MLLDAGPQFPAIGVGSFARHHHHSAAAAAAAAAEMQDRELSLAAAQNGFVDSAAAHMGAF
KLNPGAHELSPGQSSAFTSQGPGAYPGSAAAAAAAAALGPHAAHVGSYSGPPFNSTRDFL
FRSRGFGDSAPGGGQHGLFGPGAGGLHHAHSDAQGHLLFPGLPEQHGPHGSQNVLNGQMR
LGLPGEVFGRSEQYRQVASPRTDPYSAAQLHNQYGPMNMNMGMNMAAAAAHHHHHHHHHP
GAFFRYMRQQCIKQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNH
VCFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGE
KPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSPQ
GSESSPAASSGYESSTPPGLVSPSAEPQSSSNLSPAAAAAAAAAAAAAAAVSAVHRGGGS
GSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSGLSSNFNEWYV
Sequence length 532
Interactions View interactions
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Agenesis of corpus callosum Agenesis of corpus callosum rs754914260, rs1057519053, rs1057519056, rs1057519054, rs1057519055, rs1057519057, rs1384496494, rs1599017933
Anencephaly Iniencephaly, Exencephaly rs773607884 15136147
Asthma Asthma rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291, rs886041382, rs1057518991, rs1057518699, rs753254213, rs748294403, rs762552974, rs1135401795, rs1553121073, rs1553122926, rs1364690005, rs1554086554, rs1554210415, rs1554168326, rs1554776342, rs1553873247, rs1567860112, rs779009256, rs1557447255, rs1564568350, rs780011005, rs1597464953, rs1200336864, rs1569513017, rs1587459606, rs1570332505, rs748888652, rs1575155995, rs2087029320, rs1589669105, rs1601769604, rs1184981709, rs749201074
Unknown
Disease name Disease term dbSNP ID References
Acrania Acrania 15136147
Alobar holoprosencephaly Alobar Holoprosencephaly
Ambiguous genitalia Ambiguous Genitalia rs782562963
Choanal atresia Choanal Atresia

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412