GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

XDH (xanthine dehydrogenase)

Gene

Xanthine dehydrogenase

XDH

XAN1, XO, XOR

2

2p23.1

Xanthine dehydrogenase belongs to the group of molybdenum-containing hydroxylases involved in the oxidative metabolism of purines. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct f

Show/Hide all(10)

SNP ID	Visualize variation	Clinical significance	Consequence
rs72549369	G>A	Pathogenic	Coding sequence variant, missense variant
rs119460972	G>A,C,T	Pathogenic	Synonymous variant, stop gained, coding sequence variant, missense variant
rs148412639	C>G,T	Likely-pathogenic, conflicting-interpretations-of-pathogenicity	Splice donor variant
rs376882470	C>G,T	Likely-pathogenic	Splice donor variant
rs760186813	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs773456900	->C	Pathogenic	Coding sequence variant, frameshift variant
rs1172253757	C>A,G	Pathogenic	Genic downstream transcript variant, splice acceptor variant
rs1553411468	G>C	Likely-pathogenic	Stop gained, coding sequence variant, genic downstream transcript variant
rs1558674294	T>-	Pathogenic	Frameshift variant, coding sequence variant, genic downstream transcript variant
rs1572530443	G>-	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(120)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028928	hsa-miR-26b-5p	Microarray	19088304
MIRT756459	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR	36920714
MIRT1495289	hsa-miR-103b	CLIP-seq
MIRT1495290	hsa-miR-1178	CLIP-seq
MIRT1495291	hsa-miR-1184	CLIP-seq
MIRT1495292	hsa-miR-129-5p	CLIP-seq
MIRT1495293	hsa-miR-154	CLIP-seq
MIRT1495294	hsa-miR-204	CLIP-seq
MIRT1495295	hsa-miR-211	CLIP-seq
MIRT1495296	hsa-miR-2116	CLIP-seq
MIRT1495297	hsa-miR-2117	CLIP-seq
MIRT1495298	hsa-miR-3074-3p	CLIP-seq
MIRT1495299	hsa-miR-3156-5p	CLIP-seq
MIRT1495300	hsa-miR-3606	CLIP-seq
MIRT1495301	hsa-miR-3660	CLIP-seq
MIRT1495302	hsa-miR-3692	CLIP-seq
MIRT1495303	hsa-miR-375	CLIP-seq
MIRT1495304	hsa-miR-4264	CLIP-seq
MIRT1495305	hsa-miR-4273	CLIP-seq
MIRT1495306	hsa-miR-4418	CLIP-seq
MIRT1495307	hsa-miR-4436b-5p	CLIP-seq
MIRT1495308	hsa-miR-4526	CLIP-seq
MIRT1495309	hsa-miR-455-3p	CLIP-seq
MIRT1495310	hsa-miR-4645-3p	CLIP-seq
MIRT1495311	hsa-miR-4677-5p	CLIP-seq
MIRT1495312	hsa-miR-4714-3p	CLIP-seq
MIRT1495313	hsa-miR-4729	CLIP-seq
MIRT1495314	hsa-miR-4753-3p	CLIP-seq
MIRT1495315	hsa-miR-4755-5p	CLIP-seq
MIRT1495316	hsa-miR-4761-5p	CLIP-seq
MIRT1495317	hsa-miR-4780	CLIP-seq
MIRT1495318	hsa-miR-4803	CLIP-seq
MIRT1495319	hsa-miR-496	CLIP-seq
MIRT1495320	hsa-miR-509-3-5p	CLIP-seq
MIRT1495321	hsa-miR-509-5p	CLIP-seq
MIRT1495322	hsa-miR-579	CLIP-seq
MIRT1495323	hsa-miR-623	CLIP-seq
MIRT1495324	hsa-miR-921	CLIP-seq
MIRT1495291	hsa-miR-1184	CLIP-seq
MIRT2149203	hsa-miR-124	CLIP-seq
MIRT2149204	hsa-miR-1244	CLIP-seq
MIRT2149205	hsa-miR-1297	CLIP-seq
MIRT2149206	hsa-miR-1302	CLIP-seq
MIRT2149207	hsa-miR-26a	CLIP-seq
MIRT2149208	hsa-miR-26b	CLIP-seq
MIRT2149209	hsa-miR-27a	CLIP-seq
MIRT2149210	hsa-miR-27b	CLIP-seq
MIRT2149211	hsa-miR-3122	CLIP-seq
MIRT2149212	hsa-miR-3199	CLIP-seq
MIRT2149213	hsa-miR-3913-5p	CLIP-seq
MIRT2149214	hsa-miR-4259	CLIP-seq
MIRT2149215	hsa-miR-4298	CLIP-seq
MIRT1495306	hsa-miR-4418	CLIP-seq
MIRT2149216	hsa-miR-4425	CLIP-seq
MIRT2149217	hsa-miR-4465	CLIP-seq
MIRT2149218	hsa-miR-4476	CLIP-seq
MIRT2149219	hsa-miR-4703-3p	CLIP-seq
MIRT1495312	hsa-miR-4714-3p	CLIP-seq
MIRT2149220	hsa-miR-4715-5p	CLIP-seq
MIRT2149221	hsa-miR-498	CLIP-seq
MIRT2149222	hsa-miR-506	CLIP-seq
MIRT1495320	hsa-miR-509-3-5p	CLIP-seq
MIRT1495321	hsa-miR-509-5p	CLIP-seq
MIRT2149223	hsa-miR-513a-5p	CLIP-seq
MIRT1495289	hsa-miR-103b	CLIP-seq
MIRT2369640	hsa-miR-106a	CLIP-seq
MIRT2369641	hsa-miR-106b	CLIP-seq
MIRT1495291	hsa-miR-1184	CLIP-seq
MIRT2369642	hsa-miR-1200	CLIP-seq
MIRT2149203	hsa-miR-124	CLIP-seq
MIRT2369643	hsa-miR-150	CLIP-seq
MIRT2369644	hsa-miR-17	CLIP-seq
MIRT2369645	hsa-miR-1976	CLIP-seq
MIRT2369646	hsa-miR-20a	CLIP-seq
MIRT2369647	hsa-miR-20b	CLIP-seq
MIRT2149209	hsa-miR-27a	CLIP-seq
MIRT2149210	hsa-miR-27b	CLIP-seq
MIRT2369648	hsa-miR-302a	CLIP-seq
MIRT2369649	hsa-miR-302b	CLIP-seq
MIRT2369650	hsa-miR-302c	CLIP-seq
MIRT2369651	hsa-miR-302d	CLIP-seq
MIRT2369652	hsa-miR-302e	CLIP-seq
MIRT2369653	hsa-miR-3119	CLIP-seq
MIRT2369654	hsa-miR-372	CLIP-seq
MIRT2369655	hsa-miR-373	CLIP-seq
MIRT2369656	hsa-miR-4269	CLIP-seq
MIRT2369657	hsa-miR-4279	CLIP-seq
MIRT2369658	hsa-miR-4324	CLIP-seq
MIRT1495306	hsa-miR-4418	CLIP-seq
MIRT2369659	hsa-miR-4422	CLIP-seq
MIRT2369660	hsa-miR-4433	CLIP-seq
MIRT2149218	hsa-miR-4476	CLIP-seq
MIRT2369661	hsa-miR-4514	CLIP-seq
MIRT2369662	hsa-miR-4692	CLIP-seq
MIRT1495312	hsa-miR-4714-3p	CLIP-seq
MIRT2369663	hsa-miR-4722-3p	CLIP-seq
MIRT2369664	hsa-miR-4722-5p	CLIP-seq
MIRT2369665	hsa-miR-4731-5p	CLIP-seq
MIRT2369666	hsa-miR-4742-5p	CLIP-seq
MIRT2369667	hsa-miR-4755-3p	CLIP-seq
MIRT2149222	hsa-miR-506	CLIP-seq
MIRT1495320	hsa-miR-509-3-5p	CLIP-seq
MIRT1495321	hsa-miR-509-5p	CLIP-seq
MIRT2369668	hsa-miR-512-3p	CLIP-seq
MIRT2149223	hsa-miR-513a-5p	CLIP-seq
MIRT2369669	hsa-miR-519d	CLIP-seq
MIRT2369670	hsa-miR-520a-3p	CLIP-seq
MIRT2369671	hsa-miR-520b	CLIP-seq
MIRT2369672	hsa-miR-520c-3p	CLIP-seq
MIRT2369673	hsa-miR-520d-3p	CLIP-seq
MIRT2369674	hsa-miR-520e	CLIP-seq
MIRT2369675	hsa-miR-520g	CLIP-seq
MIRT2369676	hsa-miR-520h	CLIP-seq
MIRT2369677	hsa-miR-544b	CLIP-seq
MIRT2369678	hsa-miR-93	CLIP-seq
MIRT2369679	hsa-miR-940	CLIP-seq
MIRT2463585	hsa-miR-1255a	CLIP-seq
MIRT2463586	hsa-miR-1255b	CLIP-seq
MIRT2463587	hsa-miR-1265	CLIP-seq
MIRT2463588	hsa-miR-2392	CLIP-seq

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001933	Process	Negative regulation of protein phosphorylation	IDA	18386220
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IDA	18386220
GO:0004854	Function	Xanthine dehydrogenase activity	IBA	21873635
GO:0004854	Function	Xanthine dehydrogenase activity	IDA	8670112
GO:0004855	Function	Xanthine oxidase activity	IDA	8670112, 17301077
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005777	Component	Peroxisome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006195	Process	Purine nucleotide catabolic process	TAS
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	18386220
GO:0007595	Process	Lactation	IEA
GO:0009055	Function	Electron transfer activity	IEA
GO:0009115	Process	Xanthine catabolic process	IBA	21873635
GO:0009115	Process	Xanthine catabolic process	IDA	8670112, 17301077
GO:0009115	Process	Xanthine catabolic process	IEA
GO:0010629	Process	Negative regulation of gene expression	IDA	18386220
GO:0016491	Function	Oxidoreductase activity	IBA	21873635
GO:0016529	Component	Sarcoplasmic reticulum	IEA
GO:0022900	Process	Electron transport chain	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	17301077
GO:0043546	Function	Molybdopterin cofactor binding	IDA	17301077
GO:0045602	Process	Negative regulation of endothelial cell differentiation	IDA	18386220
GO:0046038	Process	GMP catabolic process	IEA
GO:0046055	Process	DGMP catabolic process	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IDA	17301077
GO:0051537	Function	2 iron, 2 sulfur cluster binding	IDA	17301077
GO:0051898	Process	Negative regulation of protein kinase B signaling	IDA	18386220
GO:0070674	Function	Hypoxanthine dehydrogenase activity	IEA
GO:0070675	Function	Hypoxanthine oxidase activity	IEA
GO:0071949	Function	FAD binding	IEA
GO:1900745	Process	Positive regulation of p38MAPK cascade	IDA	18386220
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IDA	18386220
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IDA	18386220
GO:2001213	Process	Negative regulation of vasculogenesis	IDA	18386220

MIM	HGNC	e!Ensembl
607633	12805	ENSG00000158125

Protein

UniProt ID

Protein name

Xanthine dehydrogenase/oxidase [Includes: Xanthine dehydrogenase (XD) (EC 1.17.1.4); Xanthine oxidase (XO) (EC 1.17.3.2) (Xanthine oxidoreductase) (XOR)]

Protein function

Key enzyme in purine degradation. Catalyzes the oxidation of hypoxanthine to xanthine. Catalyzes the oxidation of xanthine to uric acid. Contributes to the generation of reactive oxygen species. Has also low oxidase activity towards aldehydes (i

PDB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00111	Fer2	8 → 78	2Fe-2S iron-sulfur cluster binding domain	Domain
PF01799	Fer2_2	87 → 161	[2Fe-2S] binding domain	Domain
PF00941	FAD_binding_5	228 → 412	FAD binding domain in molybdopterin dehydrogenase	Family
PF03450	CO_deh_flav_C	419 → 523	CO dehydrogenase flavoprotein C-terminal domain	Domain
PF01315	Ald_Xan_dh_C	588 → 694	Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain	Domain
PF02738	Ald_Xan_dh_C2	699 → 1237	Molybdopterin-binding domain of aldehyde dehydrogenase	Family

Sequence

MTADKLVFFVNGRKVVEKNADPETTLLAYLRRKLGLSGTKLGCGEGGCGACTVMLSKYDR
LQNKIVHFSANACLAPICSLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGI
VMSMYTLLRNQPEPTMEEIENAFQGNLCRCTGYRPILQGFRTFARDGGCCGGDGNNPNCC
MNQKKDHSVSLSPSLFKPEEFTPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQAS
TLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHGPDGISFG
AACPLSIVEKTLVDAVAKLPAQKTEVFRGVLEQLRWFAGKQVKSVASVGGNIITASPISD
LNPVFMASGAKLTLVSRGTRRTVQMDHTFFPGYRKTLLSPEEILLSIEIPYSREGEYFSA
FKQASRREDDIAKVTSGMRVLFKPGTTEVQELALCYGGMANRTISALKTTQRQLSKLWKE
ELLQDVCAGLAEELHLPPDAPGGMVDFRCTLTLSFFFKFYLTVLQKLGQENLEDKCGKLD
PTFASATLLFQKDPPADVQLFQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYCDDIPRY
ENELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISADDVPGSNITGICNDETVFAKDK
VTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDL
KKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVPKGEAGEMELFVSTQNTMKTQSFVAKM
LGVPANRIVVRVKRMGGGFGGKETRSTVVSTAVALAAYKTGRPVRCMLDRDEDMLITGGR
HPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFHMDNCYKIPNIRGTGR
LCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEGDLTHFNQKL
EGFTLPRCWEECLASSQYHARKSEVDKFNKENCWKKRGLCIIPTKFGISFTVPFLNQAGA
LLHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAA
SVSADLNGQAVYAACQTILKRLEPYKKKNPSGSWEDWVTAAYMDTVSLSATGFYRTPNLG
YSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAF
VQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKKAIYASKAV
GEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVT
GVPENCKPWSVRV

Sequence length

1333

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Caffeine metabolism Drug metabolism - other enzymes Metabolic pathways Nucleotide metabolism Peroxisome		Purine catabolism Butyrophilin (BTN) family interactions

Associated diseases

Show/Hide Causal Diseases (6)

Causal
Disease name	Disease term	dbSNP ID	References
Autism	Autistic Disorder	rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634	15205966
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243
Carcinoma	Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	12376462
Myocardial infarction	Myocardial Failure	rs12316150, rs41303970, rs909253, rs7291467, rs2234693	19933411
Myopathy	Myopathy	rs137854521, rs386834236, rs121908557, rs121909092, rs111033570, rs104894299, rs104894294, rs121909273, rs121909274, rs121909275, rs199474699, rs199476140, rs118192165, rs118192169, rs118192166, rs193922856, rs281865489, rs397514675, rs397514676, rs397514677, rs367543058, rs118192117, rs193922837, rs118192129, rs118192143, rs118192153, rs118192133, rs118192156, rs118192149, rs118192148, rs118192183, rs118192147, rs118192123, rs118192127, rs118192142, rs118192144, rs118192178, rs118192151, rs118192150, rs118192184, rs118192154, rs118192134, rs118192155, rs193922893, rs118192132, rs118192146, rs193922867, rs193922884, rs587777528, rs527236030, rs587777672, rs587777673, rs587777674, rs587777675, rs587783343, rs2754158, rs786204796, rs748277951, rs797046047, rs797046064, rs797046060, rs797045479, rs797045931, rs797045932, rs797045934, rs797045935, rs797045477, rs797045478, rs1057518851, rs1057518855, rs1057518773, rs1057518866, rs1555322610, rs1555806119, rs761483896, rs144071404, rs1198364572, rs1568614042, rs978984063, rs1568604308, rs1332371891, rs1601842249, rs777176261, rs1249621033, rs1278804520, rs1568613962, rs1568510406, rs1597512576, rs193922887, rs371455345, rs1603452200, rs1599634685, rs1575065895, rs1575201712, rs139715157, rs1974129338
Xanthinuria	Xanthinuria, Xanthinuria, Type I, Xanthinuria, Type II, Xanthinuria type I	rs119460972, rs142150953, rs886037854, rs750896617, rs886037855, rs751921838, rs376882470, rs760186813, rs1558674294, rs773456900	10844591, 14551354, 9153281, 11379872, 9153281

Show/Hide Unknown Diseases (16)

Unknown
Disease name	Disease term	dbSNP ID	References
Alopecia	Alopecia		28196072
Anaplastic carcinoma	Anaplastic carcinoma		12376462
Cerebral infraction	Infarction, Middle Cerebral Artery		12374626
Cerebral thrombosis	Middle Cerebral Artery Thrombosis		12374626
Congestive heart failure	Congestive heart failure	rs2301610, rs3833910, rs12301951, rs201674674, rs186741807, rs150140412, rs786205727, rs757840030, rs552050895, rs759465783, rs201978086, rs572757800, rs1572143354, rs749160569	19933411
Gout	Gout		29071757
Heart diseases	Heart Diseases		17217956
Heart failure	Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided	rs121918074, rs142027794, rs148791216, rs72648927, rs71578935, rs142416150, rs199830512, rs755445214, rs150102469, rs779568205, rs907992794, rs1202130741	19933411
Hydronephrosis	Hydronephrosis
Hyperuricemia	Hyperuricemia		29071757
Involutional depression	Involutional Depression		20471444
Involutional paraphrenia	Involutional paraphrenia		20471444
Mental depression	Major Depressive Disorder	rs587778876, rs587778877	20471444
Psychosis	Psychosis, Involutional		20471444
Pulmonary thromboembolism	Pulmonary Thromboembolisms		2510358
Pyelonephritis	Pyelonephritis

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412