WNT2 (Wnt family member 2)

Gene

• Entrez ID: 7472
• Gene name: Wnt family member 2
• Gene symbol: WNT2
• Synonyms: INT1L1, IRP
• Chromosome: 7
• Chromosome location: 7q31.2
• Summary: This gene is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulat

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025070	hsa-miR-181a-5p	Microarray	17612493
MIRT438595	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT438595	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT438595	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT438595	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT438595	hsa-miR-199a-5p	Luciferase reporter assay, Next Generation Sequencing (NGS), qRT-PCR, Western blot	25596533
MIRT732830	hsa-miR-30a-3p	Immunofluorescence, Luciferase reporter assay, RNA-seq, Western blotting	33397440
MIRT755966	hsa-miR-320e	Luciferase reporter assay, Western blotting, qRT-PCR	37771642
MIRT1493629	hsa-miR-1321	CLIP-seq
MIRT1493630	hsa-miR-1468	CLIP-seq
MIRT1493631	hsa-miR-3160-5p	CLIP-seq
MIRT1493632	hsa-miR-4270	CLIP-seq
MIRT1493633	hsa-miR-4441	CLIP-seq
MIRT1493634	hsa-miR-4511	CLIP-seq
MIRT1493635	hsa-miR-452	CLIP-seq
MIRT1493636	hsa-miR-4676-3p	CLIP-seq
MIRT1493637	hsa-miR-4693-5p	CLIP-seq
MIRT1493638	hsa-miR-4739	CLIP-seq
MIRT1493639	hsa-miR-4756-5p	CLIP-seq
MIRT1493640	hsa-miR-548b-3p	CLIP-seq
MIRT2148786	hsa-miR-1305	CLIP-seq
MIRT2369180	hsa-miR-296-5p	CLIP-seq
MIRT2463529	hsa-miR-2053	CLIP-seq
MIRT2463530	hsa-miR-569	CLIP-seq
MIRT2463529	hsa-miR-2053	CLIP-seq
MIRT2463530	hsa-miR-569	CLIP-seq
MIRT2463529	hsa-miR-2053	CLIP-seq
MIRT2463530	hsa-miR-569	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PITX2	Unknown	23250740

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0002088	Process	Lens development in camera-type eye	ISS	16258938
GO:0005109	Function	Frizzled binding	IBA	21873635
GO:0005109	Function	Frizzled binding	IPI	10557084, 19038973
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005125	Function	Cytokine activity	IDA	10557084
GO:0005515	Function	Protein binding	IPI	10347172
GO:0005576	Component	Extracellular region	NAS	2971536
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	19038973, 19239325, 23610556
GO:0007267	Process	Cell-cell signaling	IDA	10557084
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10347172
GO:0016055	Process	Wnt signaling pathway	TAS
GO:0022008	Process	Neurogenesis	TAS	24431302
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0030182	Process	Neuron differentiation	ISS
GO:0030324	Process	Lung development	IEA
GO:0031232	Component	Extrinsic component of external side of plasma membrane	IDA	19038973
GO:0033278	Process	Cell proliferation in midbrain	IDA	20018874
GO:0045165	Process	Cell fate commitment	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20018874
GO:0048018	Function	Receptor ligand activity	IDA	10557084
GO:0048018	Function	Receptor ligand activity	IMP	17948129
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	19734317
GO:0050769	Process	Positive regulation of neurogenesis	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	10557084
GO:0055009	Process	Atrial cardiac muscle tissue morphogenesis	IEA
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA	21873635
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	10347172, 10557084, 20018874
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	17948129
GO:0060070	Process	Canonical Wnt signaling pathway	TAS	24431302
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	IEA
GO:0060492	Process	Lung induction	IEA
GO:0060501	Process	Positive regulation of epithelial cell proliferation involved in lung morphogenesis	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0061072	Process	Iris morphogenesis	ISS	16258938
GO:0061180	Process	Mammary gland epithelium development	IEP	8168088
GO:0062023	Component	Collagen-containing extracellular matrix	IDA	15507471
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEP	15040835
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	IDA	20018874
GO:1904954	Process	Canonical Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation	IDA	20018874
GO:1990909	Component	Wnt signalosome	IC	10557084

Other IDs

• MIM: 147870
• HGNC: 12780
• e!Ensembl: ENSG00000105989

Protein

• UniProt ID: P09544
• Protein name: Protein Wnt-2 (Int-1-like protein 1) (Int-1-related protein) (IRP)
• Protein function: Ligand for members of the frizzled family of seven transmembrane receptors. Functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family (PubMed:20018874). Functions as a upstream reg
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00110	wnt	43 → 349	wnt family	Family

• Sequence:

  MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPD
  VMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
  FAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGK
  DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
  AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
  MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTAT
  

• Sequence length: 360

Pathways

KEGG:

mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

WNT ligand biogenesis and trafficking

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Autism	Autistic Disorder	rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634	19895723, 11449391
Cervical cancer	cervical cancer	rs28934571, rs121913482, rs121913483	25061499

Unknown
Disease name	Disease term	dbSNP ID	References
Uterine cervix neoplasm	Uterine Cervical Neoplasm		25061499
Dupuytren contracture	Dupuytren Contracture, Dupuytren`s Disease		21732829