GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

WIPF1 (WAS/WASL interacting protein family member 1)

Gene

7456

WAS/WASL interacting protein family member 1

WIPF1

PRPL-2, WAS2, WASPIP, WIP

2q31.1

This gene encodes a protein that plays an important role in the organization of the actin cytoskeleton. The encoded protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1574785867	G>C	Pathogenic	Stop gained, genic downstream transcript variant, coding sequence variant

Show/Hide all(101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003872	hsa-miR-15a-5p	Microarray	18362358
MIRT004366	hsa-miR-16-5p	Microarray	18362358
MIRT022917	hsa-miR-124-3p	Microarray	18668037
MIRT053462	hsa-miR-200c-3p	Microarray	23807165
MIRT441697	hsa-miR-99a-3p	PAR-CLIP	22100165
MIRT441696	hsa-miR-99b-3p	PAR-CLIP	22100165
MIRT441695	hsa-miR-3917	PAR-CLIP	22100165
MIRT441694	hsa-miR-5002-3p	PAR-CLIP	22100165
MIRT441693	hsa-miR-1288-3p	PAR-CLIP	22100165
MIRT441697	hsa-miR-99a-3p	PAR-CLIP	22100165
MIRT441696	hsa-miR-99b-3p	PAR-CLIP	22100165
MIRT441695	hsa-miR-3917	PAR-CLIP	22100165
MIRT441694	hsa-miR-5002-3p	PAR-CLIP	22100165
MIRT441693	hsa-miR-1288-3p	PAR-CLIP	22100165
MIRT1492719	hsa-miR-1178	CLIP-seq
MIRT1492720	hsa-miR-135a	CLIP-seq
MIRT1492721	hsa-miR-135b	CLIP-seq
MIRT1492722	hsa-miR-28-5p	CLIP-seq
MIRT1492723	hsa-miR-3119	CLIP-seq
MIRT1492724	hsa-miR-3139	CLIP-seq
MIRT1492725	hsa-miR-3157-5p	CLIP-seq
MIRT1492726	hsa-miR-3664-3p	CLIP-seq
MIRT1492727	hsa-miR-3692	CLIP-seq
MIRT1492728	hsa-miR-4433	CLIP-seq
MIRT1492729	hsa-miR-4459	CLIP-seq
MIRT1492730	hsa-miR-4691-3p	CLIP-seq
MIRT1492731	hsa-miR-4768-3p	CLIP-seq
MIRT1492732	hsa-miR-708	CLIP-seq
MIRT1492733	hsa-miR-1183	CLIP-seq
MIRT1492734	hsa-miR-1184	CLIP-seq
MIRT1492735	hsa-miR-1255a	CLIP-seq
MIRT1492736	hsa-miR-1255b	CLIP-seq
MIRT1492737	hsa-miR-1279	CLIP-seq
MIRT1492738	hsa-miR-1299	CLIP-seq
MIRT1492739	hsa-miR-1301	CLIP-seq
MIRT1492740	hsa-miR-1321	CLIP-seq
MIRT1492741	hsa-miR-141	CLIP-seq
MIRT1492742	hsa-miR-153	CLIP-seq
MIRT1492743	hsa-miR-1827	CLIP-seq
MIRT1492744	hsa-miR-196a	CLIP-seq
MIRT1492745	hsa-miR-196b	CLIP-seq
MIRT1492746	hsa-miR-1976	CLIP-seq
MIRT1492747	hsa-miR-200a	CLIP-seq
MIRT1492748	hsa-miR-200b	CLIP-seq
MIRT1492749	hsa-miR-200c	CLIP-seq
MIRT1492750	hsa-miR-2054	CLIP-seq
MIRT1492751	hsa-miR-299-3p	CLIP-seq
MIRT1492752	hsa-miR-30a	CLIP-seq
MIRT1492753	hsa-miR-30b	CLIP-seq
MIRT1492754	hsa-miR-30c	CLIP-seq
MIRT1492755	hsa-miR-30d	CLIP-seq
MIRT1492756	hsa-miR-30e	CLIP-seq
MIRT1492723	hsa-miR-3119	CLIP-seq
MIRT1492757	hsa-miR-3163	CLIP-seq
MIRT1492758	hsa-miR-3185	CLIP-seq
MIRT1492759	hsa-miR-3202	CLIP-seq
MIRT1492760	hsa-miR-331-5p	CLIP-seq
MIRT1492761	hsa-miR-3606	CLIP-seq
MIRT1492762	hsa-miR-3607-5p	CLIP-seq
MIRT1492763	hsa-miR-3662	CLIP-seq
MIRT1492764	hsa-miR-374c	CLIP-seq
MIRT1492765	hsa-miR-3927	CLIP-seq
MIRT1492766	hsa-miR-3935	CLIP-seq
MIRT1492767	hsa-miR-4270	CLIP-seq
MIRT1492768	hsa-miR-4279	CLIP-seq
MIRT1492769	hsa-miR-4282	CLIP-seq
MIRT1492770	hsa-miR-429	CLIP-seq
MIRT1492771	hsa-miR-4441	CLIP-seq
MIRT1492772	hsa-miR-4457	CLIP-seq
MIRT1492773	hsa-miR-4476	CLIP-seq
MIRT1492774	hsa-miR-4491	CLIP-seq
MIRT1492775	hsa-miR-4514	CLIP-seq
MIRT1492776	hsa-miR-4657	CLIP-seq
MIRT1492777	hsa-miR-4660	CLIP-seq
MIRT1492778	hsa-miR-4666-3p	CLIP-seq
MIRT1492779	hsa-miR-4680-5p	CLIP-seq
MIRT1492780	hsa-miR-4682	CLIP-seq
MIRT1492781	hsa-miR-4692	CLIP-seq
MIRT1492782	hsa-miR-4724-5p	CLIP-seq
MIRT1492783	hsa-miR-4729	CLIP-seq
MIRT1492784	hsa-miR-4739	CLIP-seq
MIRT1492785	hsa-miR-4756-5p	CLIP-seq
MIRT1492786	hsa-miR-4778-5p	CLIP-seq
MIRT1492787	hsa-miR-4779	CLIP-seq
MIRT1492788	hsa-miR-4782-5p	CLIP-seq
MIRT1492789	hsa-miR-4790-3p	CLIP-seq
MIRT1492790	hsa-miR-5047	CLIP-seq
MIRT1492791	hsa-miR-516b	CLIP-seq
MIRT1492792	hsa-miR-618	CLIP-seq
MIRT1492793	hsa-miR-655	CLIP-seq
MIRT1492794	hsa-miR-765	CLIP-seq
MIRT1492795	hsa-miR-940	CLIP-seq
MIRT2148563	hsa-miR-494	CLIP-seq
MIRT2396993	hsa-miR-4659a-3p	CLIP-seq
MIRT2396994	hsa-miR-4659b-3p	CLIP-seq
MIRT1492746	hsa-miR-1976	CLIP-seq
MIRT1492768	hsa-miR-4279	CLIP-seq
MIRT2434714	hsa-miR-767-5p	CLIP-seq
MIRT1492720	hsa-miR-135a	CLIP-seq
MIRT1492721	hsa-miR-135b	CLIP-seq
MIRT1492723	hsa-miR-3119	CLIP-seq

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IEA
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	9405671, 10202051, 11331876, 12029088, 12591280, 12620186, 16488394, 16582881, 17213309, 17606906, 19805221, 20936779, 21398607, 21516116, 21706016, 21988832, 23414517, 25416956, 28514442, 29892012
GO:0005522	Function	Profilin binding	TAS	9405671
GO:0005829	Component	Cytosol	TAS
GO:0005884	Component	Actin filament	IBA	21873635
GO:0008154	Process	Actin polymerization or depolymerization	IEA
GO:0015629	Component	Actin cytoskeleton	TAS	9405671
GO:0017124	Function	SH3 domain binding	IPI	19798448
GO:0030048	Process	Actin filament-based movement	IBA	21873635
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0051707	Process	Response to other organism	IEA
GO:0065003	Process	Protein-containing complex assembly	TAS	9405671

MIM	HGNC	e!Ensembl
602357	12736	ENSG00000115935

Protein

UniProt ID

O43516

Protein name

WAS/WASL-interacting protein family member 1 (Protein PRPL-2) (Wiskott-Aldrich syndrome protein-interacting protein) (WASP-interacting protein)

Protein function

Plays a role in the reorganization of the actin cytoskeleton. Contributes with NCK1 and GRB2 in the recruitment and activation of WASL. May participate in regulating the subcellular localization of WASL, resulting in the disassembly of stress fi

PDB

2A41 , 9EZN , 9EZO , 9EZP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02205	WH2	29 → 55	WH2 motif	Family

Sequence

MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILD
KPKGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDND
SGGSRPPLLPPGGRSTSAKPFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKP
DSIPPPVPSTPRPIQSSPHNRGSPPVPGGPRQPSPGPTPPPFPGNRGTALGGGSIRQSPL
SSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVPSTPRP
SASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPSPGRSGPLPPP
PSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPP
DRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLA
RNESRSGSNRRERGAPPLPPIPR

Sequence length

503

Interactions

View interactions

	KEGG		Reactome
	Endocytosis Pathogenic Escherichia coli infection Yersinia infection		Regulation of actin dynamics for phagocytic cup formation RHO GTPases Activate WASPs and WAVEs FCGR3A-mediated phagocytosis

Associated diseases

Show/Hide Causal Diseases (11)

Causal
Disease name	Disease term	dbSNP ID	References
Anemia	Anemia, Hemolytic, Iron-Refractory Iron Deficiency Anemia	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505
Arthritis	Arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Atrial fibrillation	Atrial Fibrillation	rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557, rs587777558, rs587777559, rs587777560, rs886037778, rs769405762, rs770372675	30061737
Chronic obstructive pulmonary disease	Chronic Obstructive Airway Disease	rs2227956, rs1008438, rs1043618, rs562047, rs1061581, rs2763979, rs6457452, rs13147758, rs1828591, rs13118928
Keratitis	Keratitis	rs587776571
Kidney disease	Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315
Leukemia	Acute leukemia, Chronic leukemia (category)	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601
Lymphoma	Lymphoma	rs11540652, rs1592119138, rs1592123162, rs1599367044
Neutropenia	Neutropenia	rs879253882
Vasculitis	Vasculitis	rs376785840, rs587777240, rs200930463, rs587777241, rs77563738, rs202134424, rs148936893, rs587777242, rs775440641, rs770689762, rs45511697, rs139750129, rs756881285, rs747774101, rs1568966771, rs766602945, rs1601419986, rs1489114116, rs754904956, rs755007390, rs368615054
Wiskott-aldrich syndrome	Wiskott-Aldrich Syndrome, WISKOTT-ALDRICH SYNDROME 2	rs2147262829, rs132630268, rs132630269, rs132630271, rs587776742, rs587776743, rs132630273, rs587776744, rs1602178087, rs1602177733, rs587776745, rs1602176299, rs1574785867, rs193922414, rs193922415, rs193922416, rs1057517845, rs886039451, rs1057520700, rs1064793293, rs1557007123, rs1557007035, rs1557006474, rs1557006672, rs1557007312, rs1557006239, rs1569494025, rs1602178800, rs1602179794, rs1602179810, rs2062432605, rs2062432653, rs2062410421, rs2062417344	22231303, 9405671, 27742395

Show/Hide Unknown Diseases (14)

Unknown
Disease name	Disease term	dbSNP ID	References
Congenital hypoplasia of thymus	Congenital hypoplasia of thymus
Conjunctivitis	Conjunctivitis
Eczema	Eczema
Hematomas	Spontaneous hematomas
Hyperostosis	Hyperostosis
Immunologic deficiency syndromes	Immunologic Deficiency Syndromes
Lymphopenia	Lymphopenia
Nervous system diseases	Peripheral Nervous System Diseases
Otitis media	Chronic otitis media	rs601338, rs1047781, rs1800028
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	rs199865688, rs397515994, rs757096307	30061737
Renal glomerular disease	Renal glomerular disease
Sinusitis	Sinusitis
Specific learning disorder	Specific learning disability	rs1057519497
Urticaria	Urticaria

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412