GediPNet logo

WAS (WASP actin nucleation promoting factor)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7454
Gene nameGene Name - the full gene name approved by the HGNC.
WASP actin nucleation promoting factor
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
WAS
SynonymsGene synonyms aliases
IMD2, SCNX, THC, THC1, WASP, WASPA
ChromosomeChromosome number
X
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp11.23
SummarySummary of gene provided in NCBI Entrez Gene.
The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that the
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs132630268 G>A,C,T Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs132630269 C>T Pathogenic Coding sequence variant, missense variant
rs132630270 C>G Pathogenic Coding sequence variant, missense variant
rs132630271 C>A,T Pathogenic Coding sequence variant, synonymous variant, stop gained
rs132630272 T>C Pathogenic Coding sequence variant, missense variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1488620 hsa-miR-1207-5p CLIP-seq
MIRT1488621 hsa-miR-1224-5p CLIP-seq
MIRT1488622 hsa-miR-1262 CLIP-seq
MIRT1488623 hsa-miR-1294 CLIP-seq
MIRT1488624 hsa-miR-3147 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
ETS1 Unknown 10066431
MYB Unknown 10066431
SP1 Unknown 10066431
SPI1 Unknown 10066431
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002625 Process Regulation of T cell antigen processing and presentation IMP 22804504
GO:0003779 Function Actin binding IEA
GO:0005515 Function Protein binding IPI 8892607, 9405671, 9422512, 9660763, 10202051, 12029088, 12235133, 12591280, 15169891, 15361624, 16488394, 17213309, 17242350, 18650809, 19234535, 19487689, 19805221, 20936779, 21516116, 21988832, 22252508, 25416956, 25502805, 31515488, 32296183
GO:0005634 Component Nucleus IDA 20574068, 29925947
GO:0005829 Component Cytosol IDA 8625410
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P42768
Protein name Actin nucleation-promoting factor WAS (Wiskott-Aldrich syndrome protein) (WASp)
Protein function Effector protein for Rho-type GTPases that regulates actin filament reorganization via its interaction with the Arp2/3 complex (PubMed:12235133, PubMed:12769847, PubMed:16275905). Important for efficient actin polymerization (PubMed:12235133, Pu
PDB 1CEE , 1EJ5 , 1T84 , 2A3Z , 2K42 , 2OT0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00568 WH1
36 145
WH1 domain
Domain
PF00786 PBD
237 296
P21-Rho-binding domain
Domain
PF02205 WH2
427 454
WH2 motif
Family
Sequence
MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEDEAQAFRALVQEKI
QKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLH
PGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIED
QGGL
EAVRQEMRRQEPLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPP
PPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALV
PAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRA
IHSSDEGEDQAGDEDEDDEWDD
Sequence length 502
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Chemokine signaling pathway
Adherens junction
Tight junction
Fc gamma R-mediated phagocytosis
Yersinia infection
Choline metabolism in cancer
  Generation of second messenger molecules
Regulation of actin dynamics for phagocytic cup formation
RHO GTPases Activate WASPs and WAVEs
FCGR3A-mediated phagocytosis
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Anemia Anemia, Hemolytic, Iron-Refractory Iron Deficiency Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505
Arthritis Arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Chronic obstructive pulmonary disease Chronic Obstructive Airway Disease rs2227956, rs1008438, rs1043618, rs562047, rs1061581, rs2763979, rs6457452, rs13147758, rs1828591, rs13118928
Congenital neutropenia Congenital neutropenia rs118203968, rs118203969, rs118203970, rs118203971, rs267606834, rs28936381, rs137854447, rs137854448, rs137854450, rs28931611, rs137854451, rs200478425, rs587777730, rs606231474, rs606231475, rs606231473, rs775224457, rs769441127, rs148559256, rs797044567, rs796065343, rs797045009, rs878855315, rs1555710005, rs879253750, rs879253882, rs1555354200, rs1555354198, rs1555354750, rs890101650, rs759302795, rs57246956, rs138156467, rs1194477276, rs1570588220, rs757401069, rs745582203, rs1191239079, rs1597905369, rs1599294750, rs1594996301, rs1595004126, rs1595004676, rs756667927, rs34019455 16804117
Unknown
Disease name Disease term dbSNP ID References
Congenital hypoplasia of thymus Congenital hypoplasia of thymus
Congenital thrombocytopenia Congenital thrombocytopenia
Conjunctivitis Conjunctivitis
Eczema Eczema

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412