GediPNet logo

VEGFA (vascular endothelial growth factor A)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7422
Gene nameGene Name - the full gene name approved by the HGNC.
Vascular endothelial growth factor A
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
VEGFA
SynonymsGene synonyms aliases
L-VEGF, MVCD1, VEGF, VPF
ChromosomeChromosome number
6
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.1
SummarySummary of gene provided in NCBI Entrez Gene.
This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for bot
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs2010963 C>G,T Risk-factor Upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs756155710 GACA>-,GACAGACA,GACAGACAGACA Likely-pathogenic 5 prime UTR variant, coding sequence variant, frameshift variant, upstream transcript variant, genic upstream transcript variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000722 hsa-miR-302d-3p Review 19574400
MIRT000721 hsa-miR-373-3p Review 19574400
MIRT003428 hsa-miR-126-3p Luciferase reporter assay 19223090
MIRT003428 hsa-miR-126-3p Luciferase reporter assay 19223090
MIRT004518 hsa-miR-205-5p Luciferase reporter assay 19238171
Transcription factors
Transcription factor Regulation Reference
AR Activation 16007189
AR Unknown 23369005
ARNT Unknown 16774940;19020709
ATF4 Activation 15788408;18829529
ATF4 Unknown 18451308;22915762;23908598
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 18093989
GO:0001525 Process Angiogenesis IDA 11427521, 21771332
GO:0001541 Process Ovarian follicle development ISS
GO:0001569 Process Branching involved in blood vessel morphogenesis IMP 23083510, 23688497
GO:0001569 Process Branching involved in blood vessel morphogenesis ISS
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P15692
Protein name Vascular endothelial growth factor A, long form (L-VEGF) (Vascular permeability factor) (VPF) [Cleaved into: N-VEGF; VEGFA]
Protein function [N-VEGF]: Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed:35455969). Involved in protecting cells from hypoxia-mediated cell death (By similarity). {ECO:00
PDB 1BJ1 , 1CZ8 , 1FLT , 1KAT , 1KMX , 1MJV , 1MKG , 1MKK , 1QTY , 1TZH , 1TZI , 1VGH , 1VPF , 1VPP , 2FJG , 2FJH , 2QR0 , 2VGH , 2VPF , 3BDY , 3P9W , 3QTK , 3S1B , 3S1K , 3V2A , 4DEQ , 4GLN , 4GLS , 4KZN , 4QAF , 4WPB , 4ZFF , 5DN2 , 5FV1 , 5FV2 , 5HHC , 5HHD , 5O4E , 5T89 , 6BFT , 6D3O , 6T9D , 6V7K , 6Z13 , 6Z3F , 6ZBR , 6ZCD , 6ZFL , 7KEZ , 7KF0 , 7KF1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00341 PDGF
52 130
PDGF/VEGF domain
Domain
PF14554 VEGF_C
180 232
VEGF heparin-binding domain
Domain
Sequence
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCEC
RPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG
PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Sequence length 232
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
VEGF signaling pathway
Focal adhesion
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Human cytomegalovirus infection
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Renal cell carcinoma
Pancreatic cancer
Bladder cancer
Rheumatoid arthritis
Fluid shear stress and atherosclerosis
  Platelet degranulation
Regulation of gene expression by Hypoxia-inducible Factor
Signaling by VEGF
VEGF ligand-receptor interactions
VEGF binds to VEGFR leading to receptor dimerization
VEGFA-VEGFR2 Pathway
VEGFR2 mediated cell proliferation
Interleukin-4 and Interleukin-13 signaling
TFAP2 (AP-2) family regulates transcription of growth factors and their receptors
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Adenocarcinoma Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular rs121913530, rs886039394, rs121913474 26432044
Alzheimer disease Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs145518263, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316 15732116
Asthma Asthma rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283 15201500, 19263519, 11907124
Carcinoma Squamous cell carcinoma, Carcinoma, Cribriform, Carcinoma, Granular Cell rs121912654, rs555607708, rs786202962, rs1564055259 26432044, 15956251, 26432044
Unknown
Disease name Disease term dbSNP ID References
Anorexia Anoxia-Ischemia, Brain, Anoxia-Ischemia, Cerebral 23694759
Anoxic-ischemic encephalopathy Anoxic-Ischemic Encephalopathy 23694759
Atherosclerosis Atherosclerosis rs699947, rs59439148 15937083
Benign neoplasm Benign Neoplasm 18494554

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412