NR1H2 (nuclear receptor subfamily 1 group H member 2)

Gene

• Entrez ID: 7376
• Gene name: Nuclear receptor subfamily 1 group H member 2
• Gene symbol: NR1H2
• Synonyms: LXR-b, LXRB, NER, NER-I, RIP15, UNR
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: The liver X receptors, LXRA (NR1H3; MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducibl

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025788	hsa-miR-7-5p	Microarray	17612493
MIRT040136	hsa-miR-615-3p	CLASH	23622248
MIRT724633	hsa-miR-1292-3p	HITS-CLIP	19536157
MIRT724632	hsa-miR-136-5p	HITS-CLIP	19536157
MIRT724633	hsa-miR-1292-3p	HITS-CLIP	19536157
MIRT724632	hsa-miR-136-5p	HITS-CLIP	19536157
MIRT1192133	hsa-miR-1237	CLIP-seq
MIRT1192134	hsa-miR-1299	CLIP-seq
MIRT1192135	hsa-miR-18a	CLIP-seq
MIRT1192136	hsa-miR-18b	CLIP-seq
MIRT1192137	hsa-miR-3127-3p	CLIP-seq
MIRT1192138	hsa-miR-3649	CLIP-seq
MIRT1192139	hsa-miR-4432	CLIP-seq
MIRT1192140	hsa-miR-4520a-5p	CLIP-seq
MIRT1192141	hsa-miR-4520b-5p	CLIP-seq
MIRT1192142	hsa-miR-4735-3p	CLIP-seq
MIRT1192143	hsa-miR-4761-5p	CLIP-seq
MIRT1192144	hsa-miR-4772-3p	CLIP-seq
MIRT1192145	hsa-miR-4782-5p	CLIP-seq
MIRT1192146	hsa-miR-492	CLIP-seq
MIRT1192147	hsa-miR-5096	CLIP-seq
MIRT1192148	hsa-miR-516b	CLIP-seq
MIRT1192149	hsa-miR-7	CLIP-seq
MIRT1192150	hsa-miR-720	CLIP-seq
MIRT1192151	hsa-miR-875-3p	CLIP-seq
MIRT1556742	hsa-miR-3690	CLIP-seq
MIRT1192135	hsa-miR-18a	CLIP-seq
MIRT1192136	hsa-miR-18b	CLIP-seq
MIRT2284550	hsa-miR-296-5p	CLIP-seq
MIRT2284551	hsa-miR-3125	CLIP-seq
MIRT1192137	hsa-miR-3127-3p	CLIP-seq
MIRT2284552	hsa-miR-3179	CLIP-seq
MIRT2284553	hsa-miR-342-5p	CLIP-seq
MIRT2284554	hsa-miR-3916	CLIP-seq
MIRT2284555	hsa-miR-3918	CLIP-seq
MIRT2284556	hsa-miR-3936	CLIP-seq
MIRT2284557	hsa-miR-4476	CLIP-seq
MIRT1192140	hsa-miR-4520a-5p	CLIP-seq
MIRT1192141	hsa-miR-4520b-5p	CLIP-seq
MIRT2284558	hsa-miR-4664-5p	CLIP-seq
MIRT2284559	hsa-miR-4685-5p	CLIP-seq
MIRT2284560	hsa-miR-4686	CLIP-seq
MIRT1192142	hsa-miR-4735-3p	CLIP-seq
MIRT1192143	hsa-miR-4761-5p	CLIP-seq
MIRT2284561	hsa-miR-939	CLIP-seq
MIRT1192137	hsa-miR-3127-3p	CLIP-seq
MIRT1192138	hsa-miR-3649	CLIP-seq
MIRT1192144	hsa-miR-4772-3p	CLIP-seq
MIRT1192146	hsa-miR-492	CLIP-seq
MIRT1192147	hsa-miR-5096	CLIP-seq
MIRT1192137	hsa-miR-3127-3p	CLIP-seq
MIRT1192138	hsa-miR-3649	CLIP-seq
MIRT1192144	hsa-miR-4772-3p	CLIP-seq
MIRT1192146	hsa-miR-492	CLIP-seq
MIRT1192147	hsa-miR-5096	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	9013544
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	9013544
GO:0003677	Function	DNA binding	TAS	7926814
GO:0004879	Function	Nuclear receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	12393874, 16189514, 19060904, 21331046, 21900206, 23931754, 25661920, 26120082, 28514442, 31515488
GO:0005634	Component	Nucleus	IDA	12393874
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	12393874
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0008270	Function	Zinc ion binding	IEA
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IC	17693624
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	IMP	17186944
GO:0010875	Process	Positive regulation of cholesterol efflux	IMP	17186944
GO:0010884	Process	Positive regulation of lipid storage	IEA
GO:0010887	Process	Negative regulation of cholesterol storage	IMP	17693624
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032270	Process	Positive regulation of cellular protein metabolic process	IMP	17186944
GO:0032369	Process	Negative regulation of lipid transport	IMP	17693624
GO:0032376	Process	Positive regulation of cholesterol transport	IDA	16141411
GO:0034191	Function	Apolipoprotein A-I receptor binding	IPI	23931754
GO:0036151	Process	Phosphatidylcholine acyl-chain remodeling	ISS
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	IMP	17186944
GO:0045861	Process	Negative regulation of proteolysis	IEA
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	12393874
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	25661920
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9013544, 16141411, 20219900
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	17186944
GO:0046965	Function	Retinoid X receptor binding	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IEA
GO:0048550	Process	Negative regulation of pinocytosis	IMP	17693624
GO:0051006	Process	Positive regulation of lipoprotein lipase activity	IMP	17186944
GO:0051117	Function	ATPase binding	IPI	23931754
GO:0060336	Process	Negative regulation of interferon-gamma-mediated signaling pathway	NAS	21268089
GO:0090108	Process	Positive regulation of high-density lipoprotein particle assembly	IEA
GO:0090187	Process	Positive regulation of pancreatic juice secretion	IEA
GO:0090340	Process	Positive regulation of secretion of lysosomal enzymes	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	21173252
GO:1903573	Process	Negative regulation of response to endoplasmic reticulum stress	ISS

Other IDs

• MIM: 600380
• HGNC: 7965
• e!Ensembl: ENSG00000131408

Protein

• UniProt ID: P55055
• Protein name: Oxysterols receptor LXR-beta (Liver X receptor beta) (Nuclear receptor NER) (Nuclear receptor subfamily 1 group H member 2) (Ubiquitously-expressed nuclear receptor)
• Protein function: Nuclear receptor that exhibits a ligand-dependent transcriptional activation activity (PubMed:25661920). Binds preferentially to double-stranded oligonucleotide direct repeats having the consensus half-site sequence 5'-AGGTCA-3' and 4-nt spacing
• PDB: 1P8D, 1PQ6, 1PQ9, 1PQC, 1UPV, 1UPW, 3KFC, 3L0E, 4DK7, 4DK8, 4NQA, 4RAK, 5HJP, 5I4V, 5JY3, 5KYA, 5KYJ, 6JIO, 6K9G, 6K9H, 6K9M, 6S4N, 6S4T, 6S4U, 6S5K
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00105	zf-C4	85 → 156	Zinc finger, C4 type (two domains)	Domain
  PF00104	Hormone_recep	256 → 444	Ligand-binding domain of nuclear hormone receptor	Domain

• Sequence:

  MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
  VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
  RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ
  SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
  SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
  ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
  RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
  LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE

• Sequence length: 460

Pathways

KEGG:

Efferocytosis
Insulin resistance

Reactome:

PPARA activates gene expression
Nuclear Receptor transcription pathway
SUMOylation of intracellular receptors
VLDLR internalisation and degradation
NR1H2 & NR1H3 regulate gene expression linked to lipogenesis
NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux
NR1H2 & NR1H3 regulate gene expression to limit cholesterol uptake
NR1H2 & NR1H3 regulate gene expression linked to triglyceride lipolysis in adipose
NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Cholestasis	Cholestasis	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039	17256725

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		21147110