SCGB1A1 (secretoglobin family 1A member 1)

Gene

• Entrez ID: 7356
• Gene name: Secretoglobin family 1A member 1
• Gene symbol: SCGB1A1
• Synonyms: CC10, CC16, CCPBP, CCSP, UGB, UP-1, UP1
• Chromosome: 11
• Chromosome location: 11q12.3
• Summary: This gene encodes a member of the secretoglobin family of small secreted proteins. The encoded protein has been implicated in numerous functions including anti-inflammation, inhibition of phospholipase A2 and the sequestering of hydrophobic ligands. Defec

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1329344	hsa-miR-1273g	CLIP-seq
MIRT1329345	hsa-miR-299-5p	CLIP-seq
MIRT1329346	hsa-miR-4708-5p	CLIP-seq
MIRT1329347	hsa-miR-4709-3p	CLIP-seq
MIRT2097669	hsa-miR-2110	CLIP-seq
MIRT2097670	hsa-miR-3150a-3p	CLIP-seq
MIRT2097671	hsa-miR-4259	CLIP-seq
MIRT2097672	hsa-miR-4450	CLIP-seq
MIRT2321892	hsa-miR-330-3p	CLIP-seq
MIRT2321893	hsa-miR-4422	CLIP-seq
MIRT2321894	hsa-miR-885-3p	CLIP-seq
MIRT2321895	hsa-miR-888	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0005515	Function	Protein binding	IPI	16423471, 18243143, 21516116, 25416956, 31515488, 32296183, 32814053
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	21805676
GO:0005635	Component	Nuclear envelope	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005791	Component	Rough endoplasmic reticulum	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007565	Process	Female pregnancy	NAS	10587371
GO:0007566	Process	Embryo implantation	TAS	10587371
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010193	Process	Response to ozone	IEA
GO:0019834	Function	Phospholipase A2 inhibitor activity	IEA
GO:0030141	Component	Secretory granule	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032689	Process	Negative regulation of interferon-gamma production	IEA
GO:0032696	Process	Negative regulation of interleukin-13 production	IEA
GO:0032713	Process	Negative regulation of interleukin-4 production	IEA
GO:0032714	Process	Negative regulation of interleukin-5 production	IEA
GO:0034021	Process	Response to silicon dioxide	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0042493	Process	Response to drug	IEA
GO:0043086	Process	Negative regulation of catalytic activity	IEA
GO:0043488	Process	Regulation of mRNA stability	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071774	Process	Response to fibroblast growth factor	IEA
GO:0097160	Function	Polychlorinated biphenyl binding	IEA

Other IDs

• MIM: 192020
• HGNC: 12523
• e!Ensembl: ENSG00000149021

Protein

• UniProt ID: P11684
• Protein name: Uteroglobin (Club cell phospholipid-binding protein) (CCPBP) (Club cells 10 kDa secretory protein) (CC10) (Secretoglobin family 1A member 1) (Urinary protein 1) (UP-1) (UP1) (Urine protein 1)
• Protein function: Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2.
• PDB: 7VF3, 7VG7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01099	Uteroglobin	1 → 90	Uteroglobin family	Domain

• Sequence:

  MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGA
  QLKKLVDTLPQKPRESIIKLMEKIAQSSLCN

• Sequence length: 91

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Chronic obstructive pulmonary disease	Chronic Obstructive Airway Disease	rs2227956, rs1008438, rs1043618, rs562047, rs1061581, rs2763979, rs6457452, rs13147758, rs1828591, rs13118928	23144326

Unknown
Disease name	Disease term	dbSNP ID	References
Lung diseases	Lung diseases		16052892
Respiration disorders	Respiration Disorders		18288317