UBE2E2 (ubiquitin conjugating enzyme E2 E2)

Gene

• Entrez ID: 7325
• Gene name: Ubiquitin conjugating enzyme E2 E2
• Gene symbol: UBE2E2
• Synonyms: UBCH8
• Chromosome: 3
• Chromosome location: 3p24.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045236	hsa-miR-186-5p	CLASH	23622248
MIRT045536	hsa-miR-149-5p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IBA	21873635
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	20061386
GO:0005515	Function	Protein binding	IPI	17460044, 19549727, 21516116, 24446487, 25416956, 26752685, 28514442, 29892012, 31515488, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006974	Process	Cellular response to DNA damage stimulus	IMP	21628527
GO:0018215	Process	Protein phosphopantetheinylation	IEA
GO:0032020	Process	ISG15-protein conjugation	IBA	21873635
GO:0032020	Process	ISG15-protein conjugation	IDA	16428300
GO:0042296	Function	ISG15 transferase activity	IBA	21873635
GO:0042296	Function	ISG15 transferase activity	IDA	16428300
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IBA	21873635
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IDA	9371400, 21628527
GO:0070534	Process	Protein K63-linked ubiquitination	IBA	21873635
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	20061386
GO:0070936	Process	Protein K48-linked ubiquitination	IBA	21873635
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	20061386
GO:0070979	Process	Protein K11-linked ubiquitination	IBA	21873635
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	20061386
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IGI	21628527

Other IDs

• MIM: 602163
• HGNC: 12478
• e!Ensembl: ENSG00000182247

Protein

• UniProt ID: Q96LR5
• Protein name: Ubiquitin-conjugating enzyme E2 E2 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme E2) (UbcH8) (Ubiquitin carrier protein E2) (Ubiquitin-protein ligase E2)
• Protein function: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Catalyzes the ISGylation of influenza A virus NS1 protein.
• PDB: 1Y6L, 6W9A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00179	UQ_con	59 → 196	Ubiquitin-conjugating enzyme	Domain

• Sequence:

  MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRI
  QKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPK
  VTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQ
  YMTNRAEHDRMARQWTKRYAT

• Sequence length: 201

Pathways

KEGG:

Ubiquitin mediated proteolysis

Reactome:

Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Disease name	Disease term	References
	Diabetes Mellitus, Non-Insulin-Dependent	23300278, 20818381, 24509480, 22885922, 30595370, 22158537, 28869590, 30718926, 30054458, 26818947
	Eczema	30595370
	Hepatocellular Adenoma	27914986
	Liver carcinoma	27914986
	Vitiligo	27723757