GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

UBB (ubiquitin B)

Gene

7314

Ubiquitin B

UBB

HEL-S-50

17p11.2

This gene encodes ubiquitin, one of the most conserved proteins known. Ubiquitin has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene e

Show/Hide all(376)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029681	hsa-miR-26b-5p	Microarray	19088304
MIRT048633	hsa-miR-99a-5p	CLASH	23622248
MIRT048512	hsa-miR-100-5p	CLASH	23622248
MIRT047262	hsa-miR-181b-5p	CLASH	23622248
MIRT040746	hsa-miR-18a-3p	CLASH	23622248
MIRT039790	hsa-miR-615-3p	CLASH	23622248
MIRT038925	hsa-miR-92a-1-5p	CLASH	23622248
MIRT038186	hsa-miR-148b-5p	CLASH	23622248
MIRT036732	hsa-miR-760	CLASH	23622248
MIRT035905	hsa-miR-1287-5p	CLASH	23622248
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	20371350
MIRT520389	hsa-miR-1285-3p	PAR-CLIP	20371350
MIRT520388	hsa-miR-3187-5p	PAR-CLIP	20371350
MIRT520387	hsa-miR-5189-5p	PAR-CLIP	20371350
MIRT520386	hsa-miR-612	PAR-CLIP	20371350
MIRT520385	hsa-miR-6860	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT520383	hsa-miR-653-3p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT520392	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	20371350
MIRT520384	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT520383	hsa-miR-653-3p	PAR-CLIP	20371350
MIRT520382	hsa-miR-4799-5p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT520381	hsa-miR-2054	PAR-CLIP	20371350
MIRT520380	hsa-miR-4263	PAR-CLIP	20371350
MIRT520379	hsa-miR-576-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	21572407
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	21572407
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT464873	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT464872	hsa-miR-4295	PAR-CLIP	21572407
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT464869	hsa-miR-3666	PAR-CLIP	21572407
MIRT464868	hsa-miR-495-5p	PAR-CLIP	21572407
MIRT464867	hsa-miR-382-5p	PAR-CLIP	21572407
MIRT464866	hsa-miR-4259	PAR-CLIP	21572407
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	21572407
MIRT464864	hsa-miR-486-3p	PAR-CLIP	21572407
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	21572407
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	21572407
MIRT464860	hsa-miR-4260	PAR-CLIP	21572407
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	23446348
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	23446348
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT464872	hsa-miR-4295	PAR-CLIP	23446348
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT464869	hsa-miR-3666	PAR-CLIP	23446348
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT520392	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT464866	hsa-miR-4259	PAR-CLIP	23446348
MIRT520391	hsa-miR-5690	PAR-CLIP	23446348
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	23446348
MIRT520389	hsa-miR-1285-3p	PAR-CLIP	23446348
MIRT520388	hsa-miR-3187-5p	PAR-CLIP	23446348
MIRT520387	hsa-miR-5189-5p	PAR-CLIP	23446348
MIRT520386	hsa-miR-612	PAR-CLIP	23446348
MIRT520385	hsa-miR-6860	PAR-CLIP	23446348
MIRT520384	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23446348
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23446348
MIRT520383	hsa-miR-653-3p	PAR-CLIP	23446348
MIRT520382	hsa-miR-4799-5p	PAR-CLIP	23446348
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23446348
MIRT520381	hsa-miR-2054	PAR-CLIP	23446348
MIRT520380	hsa-miR-4263	PAR-CLIP	23446348
MIRT520379	hsa-miR-576-5p	PAR-CLIP	23446348
MIRT464860	hsa-miR-4260	PAR-CLIP	23446348
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT464872	hsa-miR-4295	PAR-CLIP	23446348
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT464869	hsa-miR-3666	PAR-CLIP	23446348
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT464866	hsa-miR-4259	PAR-CLIP	23446348
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23446348
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23446348
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23446348
MIRT464860	hsa-miR-4260	PAR-CLIP	23446348
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	23592263
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	23592263
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT464872	hsa-miR-4295	PAR-CLIP	23592263
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT464869	hsa-miR-3666	PAR-CLIP	23592263
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23592263
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23592263
MIRT464866	hsa-miR-4259	PAR-CLIP	23592263
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23592263
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23592263
MIRT464860	hsa-miR-4260	PAR-CLIP	23592263
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	20371350
MIRT520389	hsa-miR-1285-3p	PAR-CLIP	20371350
MIRT520388	hsa-miR-3187-5p	PAR-CLIP	20371350
MIRT520387	hsa-miR-5189-5p	PAR-CLIP	20371350
MIRT520386	hsa-miR-612	PAR-CLIP	20371350
MIRT520385	hsa-miR-6860	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT520383	hsa-miR-653-3p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT520392	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	20371350
MIRT520384	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT520383	hsa-miR-653-3p	PAR-CLIP	20371350
MIRT520382	hsa-miR-4799-5p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT520381	hsa-miR-2054	PAR-CLIP	20371350
MIRT520380	hsa-miR-4263	PAR-CLIP	20371350
MIRT520379	hsa-miR-576-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	21572407
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	21572407
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT464873	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT464872	hsa-miR-4295	PAR-CLIP	21572407
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT464869	hsa-miR-3666	PAR-CLIP	21572407
MIRT464868	hsa-miR-495-5p	PAR-CLIP	21572407
MIRT464867	hsa-miR-382-5p	PAR-CLIP	21572407
MIRT464866	hsa-miR-4259	PAR-CLIP	21572407
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	21572407
MIRT464864	hsa-miR-486-3p	PAR-CLIP	21572407
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	21572407
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	21572407
MIRT464860	hsa-miR-4260	PAR-CLIP	21572407
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	23446348
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	23446348
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT464872	hsa-miR-4295	PAR-CLIP	23446348
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT464869	hsa-miR-3666	PAR-CLIP	23446348
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT520392	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT464866	hsa-miR-4259	PAR-CLIP	23446348
MIRT520391	hsa-miR-5690	PAR-CLIP	23446348
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	23446348
MIRT520389	hsa-miR-1285-3p	PAR-CLIP	23446348
MIRT520388	hsa-miR-3187-5p	PAR-CLIP	23446348
MIRT520387	hsa-miR-5189-5p	PAR-CLIP	23446348
MIRT520386	hsa-miR-612	PAR-CLIP	23446348
MIRT520385	hsa-miR-6860	PAR-CLIP	23446348
MIRT520384	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23446348
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23446348
MIRT520383	hsa-miR-653-3p	PAR-CLIP	23446348
MIRT520382	hsa-miR-4799-5p	PAR-CLIP	23446348
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23446348
MIRT520381	hsa-miR-2054	PAR-CLIP	23446348
MIRT520380	hsa-miR-4263	PAR-CLIP	23446348
MIRT520379	hsa-miR-576-5p	PAR-CLIP	23446348
MIRT464860	hsa-miR-4260	PAR-CLIP	23446348
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT464872	hsa-miR-4295	PAR-CLIP	23446348
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT464869	hsa-miR-3666	PAR-CLIP	23446348
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT464866	hsa-miR-4259	PAR-CLIP	23446348
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23446348
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23446348
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23446348
MIRT464860	hsa-miR-4260	PAR-CLIP	23446348
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	23592263
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	23592263
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT464872	hsa-miR-4295	PAR-CLIP	23592263
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT464869	hsa-miR-3666	PAR-CLIP	23592263
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23592263
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23592263
MIRT464866	hsa-miR-4259	PAR-CLIP	23592263
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23592263
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23592263
MIRT464860	hsa-miR-4260	PAR-CLIP	23592263
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT1466901	hsa-miR-3143	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466904	hsa-miR-4477a	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT1466906	hsa-miR-543	CLIP-seq
MIRT1466907	hsa-miR-891a	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT2654788	hsa-miR-3136-5p	CLIP-seq
MIRT2654789	hsa-miR-3185	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT2654790	hsa-miR-4439	CLIP-seq
MIRT2654791	hsa-miR-4513	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT2654792	hsa-miR-4659a-5p	CLIP-seq
MIRT2654793	hsa-miR-4659b-5p	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT2654788	hsa-miR-3136-5p	CLIP-seq
MIRT2654789	hsa-miR-3185	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT2654790	hsa-miR-4439	CLIP-seq
MIRT2654791	hsa-miR-4513	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT2654792	hsa-miR-4659a-5p	CLIP-seq
MIRT2654793	hsa-miR-4659b-5p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
HSF1	Unknown	20692357

Show/Hide all(82)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000715	Process	Nucleotide-excision repair, DNA damage recognition	TAS
GO:0000717	Process	Nucleotide-excision repair, DNA duplex unwinding	TAS
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS
GO:0002756	Process	MyD88-independent toll-like receptor signaling pathway	TAS
GO:0005515	Function	Protein binding	IPI	14755250, 14764729, 15039775, 15143060, 15308666, 16189514, 16286470, 16499958, 17310990, 17662948, 17719543, 18029035, 18313049, 20924359, 21516116, 24981860, 28514442, 32296183, 32814053
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005739	Component	Mitochondrion	IDA	17571083
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006283	Process	Transcription-coupled nucleotide-excision repair	TAS
GO:0006294	Process	Nucleotide-excision repair, preincision complex assembly	TAS
GO:0006296	Process	Nucleotide-excision repair, DNA incision, 5'-to lesion	TAS
GO:0006297	Process	Nucleotide-excision repair, DNA gap filling	TAS
GO:0006625	Process	Protein targeting to peroxisome	TAS
GO:0007141	Process	Male meiosis I	IEA
GO:0007144	Process	Female meiosis I	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	TAS
GO:0007254	Process	JNK cascade	TAS
GO:0008585	Process	Female gonad development	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0016055	Process	Wnt signaling pathway	TAS
GO:0016197	Process	Endosomal transport	TAS
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0016567	Process	Protein ubiquitination	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019058	Process	Viral life cycle	TAS
GO:0019068	Process	Virion assembly	TAS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019941	Process	Modification-dependent protein catabolic process	IBA	21873635
GO:0019985	Process	Translesion synthesis	TAS
GO:0021888	Process	Hypothalamus gonadotrophin-releasing hormone neuron development	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031386	Function	Protein tag	IBA	21873635
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	24660806
GO:0031625	Function	Ubiquitin protein ligase binding	IBA	21873635
GO:0031982	Component	Vesicle	HDA	19190083
GO:0033683	Process	Nucleotide-excision repair, DNA incision	TAS
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0036297	Process	Interstrand cross-link repair	TAS
GO:0042276	Process	Error-prone translesion synthesis	TAS
GO:0042769	Process	DNA damage response, detection of DNA damage	TAS
GO:0043005	Component	Neuron projection	IDA	17571083
GO:0043025	Component	Neuronal cell body	IDA	17571083
GO:0043065	Process	Positive regulation of apoptotic process	TAS
GO:0043066	Process	Negative regulation of apoptotic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043657	Component	Host cell	IEA
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS
GO:0047497	Process	Mitochondrion transport along microtubule	IDA	17571083
GO:0048812	Process	Neuron projection morphogenesis	IMP	17571083
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	TAS
GO:0051403	Process	Stress-activated MAPK cascade	TAS
GO:0051881	Process	Regulation of mitochondrial membrane potential	IDA	17571083
GO:0055085	Process	Transmembrane transport	TAS
GO:0060613	Process	Fat pad development	IEA
GO:0061024	Process	Membrane organization	TAS
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IDA	17571083
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070423	Process	Nucleotide-binding oligomerization domain containing signaling pathway	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070911	Process	Global genome nucleotide-excision repair	TAS
GO:0070987	Process	Error-free translesion synthesis	TAS
GO:0072520	Process	Seminiferous tubule development	IEA
GO:0075733	Process	Intracellular transport of virus	TAS
GO:0097009	Process	Energy homeostasis	IEA
GO:1901214	Process	Regulation of neuron death	IDA	17571083
GO:1902255	Process	Positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator	IDA	17571083
GO:1902527	Process	Positive regulation of protein monoubiquitination	IMP	24660806

MIM	HGNC	e!Ensembl
191339	12463	ENSG00000170315

Protein

UniProt ID

P0CG47

Protein name

Polyubiquitin-B [Cleaved into: Ubiquitin]

Protein function

[Ubiquitin]: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys re

PDB

2KHW , 2MBB , 2MRO , 2MSG , 2N13 , 4UEL , 4UF6 , 4WHV , 4WLR , 4WUR , 4XOF , 4ZFR , 4ZFT , 4ZPZ , 4ZUX , 5BNB , 5CAW , 5CRA , 5CVM , 5CVN , 5CVO , 5D0K , 5D0M , 5DFL , 5DK8 , 5E6J , 5EDV , 5EMZ , 5EYA , 5GJQ , 5GO7 , 5GO8 , 5GOB , 5GOC , 5GOD , 5GOG , 5GOH , 5GOI , 5GOJ , 5GOK , 5H7S , 5IBK , 5IFR , 5JBY , 5JG6 , 5JP3 , 5JTJ , 5JTV , 5K9P , 5KGF , 5KHY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00240	ubiquitin	3 → 74	Ubiquitin family	Domain
PF00240	ubiquitin	79 → 150	Ubiquitin family	Domain
PF00240	ubiquitin	155 → 226	Ubiquitin family	Domain

Sequence

MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC

Sequence length

229

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis Mitophagy - animal Autophagy - animal Parkinson disease Pathways of neurodegeneration - multiple diseases Shigellosis Kaposi sarcoma-associated herpesvirus infection		Translesion synthesis by REV1 Recognition of DNA damage by PCNA-containing replication complex Translesion Synthesis by POLH Activation of NF-kappaB in B cells ISG15 antiviral mechanism Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants Downregulation of ERBB4 signaling Spry regulation of FGF signaling Downregulation of ERBB2:ERBB3 signaling Budding and maturation of HIV virion NOD1/2 Signaling Pathway TICAM1, RIP1-mediated IKK complex recruitment DDX58/IFIH1-mediated induction of interferon-alpha/beta APC/C:Cdc20 mediated degradation of Cyclin B Autodegradation of Cdh1 by Cdh1:APC/C SCF-beta-TrCP mediated degradation of Emi1 APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Membrane binding and targetting of GAG proteins Assembly Of The HIV Virion APC-Cdc20 mediated degradation of Nek2A Vpu mediated degradation of CD4 Vif-mediated degradation of APOBEC3G EGFR downregulation SCF(Skp2)-mediated degradation of p27/p21 Degradation of beta-catenin by the destruction complex TCF dependent signaling in response to WNT Downstream TCR signaling NRIF signals cell death from the nucleus p75NTR recruits signalling complexes NF-kB is activated and signals survival Activated NOTCH1 Transmits Signal to the Nucleus Downregulation of TGF-beta receptor signaling TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition) Downregulation of SMAD2/3:SMAD4 transcriptional activity SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription Separation of Sister Chromatids Oxidative Stress Induced Senescence Senescence-Associated Secretory Phenotype (SASP) Oncogene Induced Senescence Regulation of PLK1 Activity at G2/M Transition Constitutive Signaling by NOTCH1 PEST Domain Mutants Stimuli-sensing channels Constitutive Signaling by NOTCH1 HD Domain Mutants FCERI mediated NF-kB activation Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants Regulation of innate immune responses to cytosolic DNA Glycogen synthesis Autodegradation of the E3 ubiquitin ligase COP1 Deactivation of the beta-catenin transactivating complex Myoclonic epilepsy of Lafora ABC-family proteins mediated transport TAK1 activates NFkB by phosphorylation and activation of IKKs complex activated TAK1 mediates p38 MAPK activation JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 AUF1 (hnRNP D0) binds and destabilizes mRNA Asymmetric localization of PCP proteins Degradation of AXIN Degradation of DVL Regulation of FZD by ubiquitination Pink/Parkin Mediated Mitophagy N-glycan trimming in the ER and Calnexin/Calreticulin cycle Regulation of TNFR1 signaling TNFR1-induced NFkappaB signaling pathway Hedgehog ligand biogenesis Hh mutants that don't undergo autocatalytic processing are degraded by ERAD Dectin-1 mediated noncanonical NF-kB signaling CLEC7A (Dectin-1) signaling Degradation of GLI1 by the proteasome GLI3 is processed to GLI3R by the proteasome Hedgehog 'on' state Negative regulation of FGFR1 signaling Negative regulation of FGFR2 signaling Negative regulation of FGFR3 signaling Negative regulation of FGFR4 signaling Translesion synthesis by POLK Translesion synthesis by POLI Termination of translesion DNA synthesis Regulation of RAS by GAPs TNFR2 non-canonical NF-kB pathway Negative regulation of MAPK pathway Regulation of necroptotic cell death NIK-->noncanonical NF-kB signaling Defective CFTR causes cystic fibrosis MAP3K8 (TPL2)-dependent MAPK1/3 activation HDR through Homologous Recombination (HRR) MAPK6/MAPK4 signaling UCH proteinases Josephin domain DUBs Ub-specific processing proteases Ovarian tumor domain proteases Metalloprotease DUBs Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks Processing of DNA double-strand break ends DNA Damage Recognition in GG-NER Formation of Incision Complex in GG-NER Gap-filling DNA repair synthesis and ligation in GG-NER Dual Incision in GG-NER Formation of TC-NER Pre-Incision Complex Transcription-Coupled Nucleotide Excision Repair (TC-NER) Dual incision in TC-NER Gap-filling DNA repair synthesis and ligation in TC-NER Fanconi Anemia Pathway Regulation of TP53 Activity through Phosphorylation Regulation of TP53 Degradation Regulation of TP53 Activity through Methylation Negative regulation of MET activity CDT1 association with the CDC6:ORC:origin complex Orc1 removal from chromatin CDK-mediated phosphorylation and removal of Cdc6 Cyclin D associated events in G1 G2/M Checkpoints Stabilization of p53 Ubiquitin Mediated Degradation of Phosphorylated Cdc25A Ubiquitin-dependent degradation of Cyclin D PTK6 Regulates RTKs and Their Effectors AKT1 and DOK1 The role of GTSE1 in G2/M progression after G2 checkpoint FBXL7 down-regulates AURKA during mitotic entry and in early mitosis Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis Downregulation of ERBB2 signaling Synthesis of active ubiquitin: roles of E1 and E2 enzymes E3 ubiquitin ligases ubiquitinate target proteins InlB-mediated entry of Listeria monocytogenes into host cell InlA-mediated entry of Listeria monocytogenes into host cells RUNX1 regulates transcription of genes involved in differentiation of HSCs Regulation of RUNX2 expression and activity Regulation of RUNX3 expression and activity Regulation of PTEN localization Regulation of PTEN stability and activity Neddylation ER Quality Control Compartment (ERQC) Regulation of expression of SLITs and ROBOs NOTCH3 Activation and Transmission of Signal to the Nucleus TICAM1-dependent activation of IRF3/IRF7 TICAM1,TRAF6-dependent induction of TAK1 complex Interleukin-1 signaling Peroxisomal protein import Regulation of signaling by CBL Endosomal Sorting Complex Required For Transport (ESCRT) Iron uptake and transport Negative regulators of DDX58/IFIH1 signaling Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon IRAK1 recruits IKK complex IKK complex recruitment mediated by RIP1 IRAK2 mediated activation of TAK1 complex TRAF6-mediated induction of TAK1 complex within TLR4 complex Prevention of phagosomal-lysosomal fusion Modulation by Mtb of host immune system Alpha-protein kinase 1 signaling pathway Aggrephagy Pexophagy TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation Amyloid fiber formation Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Show/Hide Causal Diseases (1)

Causal
Disease name	Disease term	dbSNP ID	References
Hearing loss	Conductive hearing loss	rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359, rs180177151, rs180177154, rs180177153, rs35689081, rs35887622, rs80338944, rs104894396, rs104894398, rs80338947, rs80338948, rs80338942, rs104894402, rs104894403, rs80338945, rs28931594, rs80338940, rs80338941, rs80356590, rs80338950, rs387906706, rs387906707, rs387906708, rs398122848, rs387907016, rs587776894, rs387907088, rs397515411, rs370965183, rs398122930, rs199897298, rs111033187, rs111033448, rs199606180, rs111033284, rs397516413, rs111033305, rs111033220, rs111033256, rs111033297, rs111033253, rs104894408, rs111033295, rs397516874, rs76434661, rs111033335, rs397517323, rs111033247, rs367928692, rs374793617, rs143939430, rs397515605, rs80338939, rs200656442, rs779748859, rs587781261, rs587781262, rs143343083, rs200147906, rs730880338, rs797044491, rs146281367, rs756484720, rs869025593, rs201306709, rs540895576, rs777777359, rs879255246, rs1554358720, rs142498437, rs377145777, rs1057517519, rs779077039, rs952741388, rs1060499797, rs764139009, rs1060499590, rs1064794012, rs1064797115, rs756790858, rs775633137, rs1554952443, rs1554952193, rs782063761, rs1199012623, rs756147087, rs1555648043, rs1555661490, rs1553196233, rs781546107, rs111033190, rs775428246, rs782539587, rs537227442, rs148695069, rs1554835827, rs953422571, rs1554834186, rs1554834161, rs1554835103, rs1554577339, rs1554577402, rs768471577, rs782279338, rs781951909, rs998045226, rs375759781, rs755804651, rs1557458426, rs767797828, rs538027448, rs1559366084, rs367688416, rs1558480402, rs1558490542, rs1559870857, rs1560690591, rs1561299289, rs1562817224, rs1562817529, rs1562822565, rs1562835391, rs1564113368, rs1564554255, rs773851192, rs1564555240, rs761261855, rs1564805114, rs1565522273, rs1565127413, rs781790246, rs1565430886, rs1565469959, rs746667217, rs1565819402, rs1565855932, rs150529554, rs1567939793, rs201866631, rs754472294, rs1559372512, rs1558464965, rs1558488902, rs775062249, rs1226171550, rs1561590396, rs765574676, rs762876554, rs757327146, rs1564949059, rs1565519673, rs368050948, rs1565541888, rs781989117, rs1565402473, rs750358148, rs1386887007, rs1209665716, rs1567641234, rs1237955948, rs1569042782, rs752672077, rs146689036, rs1560070780, rs149712664, rs1564556995, rs762226905, rs773573968, rs1568528171, rs1198256157, rs377267777, rs370564476, rs1577876794, rs747787770, rs759432278, rs1043716893, rs1581138934, rs2033773650, rs1421964916, rs771766431, rs780917129, rs1895773215, rs1895769400, rs761543680, rs1565920060

Show/Hide Unknown Diseases (9)

Unknown
Disease name	Disease term	dbSNP ID	References
Cleft soft palate	Cleft Soft Palate		17468296
Cleft uvula	Cleft uvula		17468296
Hypoplasia of the maxilla	Hypoplasia of the maxilla
Oropharyngeal dysphagia	Oropharyngeal Dysphagia
Otitis media	Recurrent otitis media	rs601338, rs1047781, rs1800028
Receptive language delay	Receptive language delay
Submucosal cleft palate	Submucous cleft of hard palate, Submucous cleft palate		17468296
Submucous cleft of soft and hard palate	Submucous cleft soft palate
Velopharyngeal insufficiency	Velopharyngeal Insufficiency

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412