GediPNet logo

TNFSF4 (TNF superfamily member 4)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7292
Gene nameGene Name - the full gene name approved by the HGNC.
TNF superfamily member 4
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TNFSF4
SynonymsGene synonyms aliases
CD134L, CD252, GP34, OX-40L, OX4OL, TNLG2B, TXGP1
ChromosomeChromosome number
1
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q25.1
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene h
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT615655 hsa-miR-8485 HITS-CLIP 23824327
MIRT670334 hsa-miR-329-3p HITS-CLIP 23824327
MIRT670333 hsa-miR-362-3p HITS-CLIP 23824327
MIRT670332 hsa-miR-603 HITS-CLIP 23824327
MIRT670331 hsa-miR-3941 HITS-CLIP 23824327
Transcription factors
Transcription factor Regulation Reference
HDAC11 Activation 21239696
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001819 Process Positive regulation of cytokine production IBA 21873635
GO:0002215 Process Defense response to nematode ISS
GO:0002526 Process Acute inflammatory response ISS
GO:0002639 Process Positive regulation of immunoglobulin production ISS
GO:0002726 Process Positive regulation of T cell cytokine production ISS
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P23510
Protein name Tumor necrosis factor ligand superfamily member 4 (Glycoprotein Gp34) (OX40 ligand) (OX40L) (TAX transcriptionally-activated glycoprotein 1) (CD antigen CD252)
Protein function Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
PDB 2HEV
Family and domains
Sequence
MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQ
SIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQ
KDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEF
CVL
Sequence length 183
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Asthma Asthma, Childhood asthma rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283 31036433
Myocardial infarction Myocardial Infarction rs12316150, rs41303970, rs909253, rs7291467, rs2234693
Narcolepsy Narcolepsy, Narcolepsy type 1 rs104894574, rs387906655 23459209
Obesity Obesity rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840
Unknown
Disease name Disease term dbSNP ID References
Amnesia Amnesia, Transient Global
Cataplexy Cataplexy
Eczema Eczema 30595370
Hallucinations Hallucinations

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412