GediPNet logo

TRAF6 (TNF receptor associated factor 6)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7189
Gene nameGene Name - the full gene name approved by the HGNC.
TNF receptor associated factor 6
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TRAF6
SynonymsGene synonyms aliases
MGC:3310, RNF85
ChromosomeChromosome number
11
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p12
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from, members of the TNF receptor superfamily. This protein mediates signaling fro
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000711 hsa-miR-146a-5p Western blot, Northern blot 18504431
MIRT000711 hsa-miR-146a-5p Luciferase reporter assay, Western blot 20061417
MIRT000711 hsa-miR-146a-5p qRT-PCR, flow, Luciferase reporter assay, Western blot 20375304
MIRT000711 hsa-miR-146a-5p qRT-PCR 18759964
MIRT000711 hsa-miR-146a-5p Immunoprecipitaion, Western blot, Communoprecipitaion 19898489
Transcription factors
Transcription factor Regulation Reference
RUNX3 Activation 17956589
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 18093978
GO:0000187 Process Activation of MAPK activity TAS
GO:0000209 Process Protein polyubiquitination IDA 15125833, 19675569
GO:0001503 Process Ossification IEA
GO:0001701 Process In utero embryonic development IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9Y4K3
Protein name TNF receptor-associated factor 6 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF6) (Interleukin-1 signal transducer) (RING finger protein 85) (RING-type E3 ubiquitin transferase TRAF6)
Protein function E3 ubiquitin ligase that, together with UBE2N and UBE2V1, mediates the synthesis of 'Lys-63'-linked-polyubiquitin chains conjugated to proteins, such as ECSIT, IKBKG, IRAK1, AKT1 and AKT2 (PubMed:11057907, PubMed:18347055, PubMed:19465916, PubMe
PDB 1LB4 , 1LB5 , 1LB6 , 2ECI , 2JMD , 3HCS , 3HCT , 3HCU , 4Z8M , 5ZUJ , 6A33 , 7L3L , 8HZ2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13923 zf-C3HC4_2
69 107
Domain
PF18048 TRAF6_Z2
157 183
TNF receptor-associated factor 6 zinc finger 2
Domain
PF02176 zf-TRAF
204 261
TRAF-type zinc finger
Family
Sequence
MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCP
RRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARH
LQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
Sequence length 522
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  MAPK signaling pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Autophagy - animal
Endocytosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
IL-17 signaling pathway
Neurotrophin signaling pathway
Alcoholic liver disease
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Pertussis
Yersinia infection
Leishmaniasis
Chagas disease
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Small cell lung cancer
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis
  PIP3 activates AKT signaling
MyD88:MAL(TIRAP) cascade initiated on plasma membrane
NOD1/2 Signaling Pathway
TICAM1, RIP1-mediated IKK complex recruitment
Regulated proteolysis of p75NTR
Downstream TCR signaling
NRIF signals cell death from the nucleus
p75NTR recruits signalling complexes
NF-kB is activated and signals survival
FCERI mediated NF-kB activation
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
activated TAK1 mediates p38 MAPK activation
JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
CLEC7A (Dectin-1) signaling
Ub-specific processing proteases
Ovarian tumor domain proteases
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
TICAM1,TRAF6-dependent induction of TAK1 complex
Interleukin-1 signaling
TRAF6 mediated IRF7 activation
TRAF6 mediated NF-kB activation
IRAK1 recruits IKK complex
IKK complex recruitment mediated by RIP1
IRAK2 mediated activation of TAK1 complex
TRAF6-mediated induction of TAK1 complex within TLR4 complex
Alpha-protein kinase 1 signaling pathway
TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling
TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation
IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation
MyD88 dependent cascade initiated on endosome
IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation
MyD88 cascade initiated on plasma membrane
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Coronary artery disease Coronary Artery Disease rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537 20524934
Hypohidrotic ectodermal dysplasia Autosomal dominant hypohidrotic ectodermal dysplasia rs104894415, rs28937872, rs104894416
Hypohidrotic ectodermal dysplasia, x-linked Autosomal dominant hypohidrotic ectodermal dysplasia syndrome (disorder) rs132630308, rs132630310, rs132630311, rs132630312, rs132630313, rs132630314, rs132630316, rs132630317, rs132630318, rs1569404873, rs1569406514, rs132630321, rs387907197, rs397516654, rs397516656, rs397516657, rs397516659, rs397516660, rs397516661, rs397516662, rs397516664, rs397516665, rs397516666, rs397516667, rs397516668, rs397516670, rs397516671, rs397516672, rs397516675, rs397516676, rs397516677, rs397516679, rs397516681, rs397516682, rs727504814, rs727505013, rs727504417, rs727503008, rs727503011, rs727505089, rs727504537, rs727504649, rs727503007, rs727503010, rs876657640, rs876657685, rs876657684, rs876657686, rs876657641, rs876657642, rs876657687, rs876657639, rs879255551, rs879255552, rs886039344, rs886039347, rs886042021, rs1057517731, rs1057520742, rs1057521131, rs1064793104, rs1064793105, rs749830948, rs1131692034, rs1556110379, rs1555972067, rs1556110934, rs1556039088, rs1556039084, rs1556092261, rs1556098384, rs1556098570, rs1556098733, rs1556110308, rs1556098978, rs886042183, rs1555972071, rs1569404780, rs1569272203, rs1569272528, rs1569384962, rs1569404950, rs1569407150, rs1569407346, rs1569272328, rs1569272194, rs1602618255, rs1602618398, rs1602622972, rs1602624745, rs1602614385, rs780966428, rs1602618442, rs1602625000, rs1602614410, rs1602221405, rs2019017595, rs2020137674, rs2020138975, rs2020139065, rs2020255486, rs2020140911
Hypotrichosis Hypotrichosis rs121434306, rs121434307, rs121434308, rs121434309, rs1325804776, rs267606775, rs786200875, rs1568062215, rs267606776, rs1462595806, rs267606777, rs267606659, rs2147483647, rs559648418, rs121917819, rs121917820, rs387906382, rs267606867, rs267606868, rs267606869, rs201868115, rs587776925, rs587777527, rs587777545, rs766783183, rs879255262, rs201249971, rs768448663, rs1566212378, rs1249530918, rs1260995701, rs1569039353, rs1827030121
Unknown
Disease name Disease term dbSNP ID References
Coronary arteriosclerosis Coronary Arteriosclerosis 20524934
Eczema Eczema
Hypodontia Hypodontia
Hypohidrosis Hypohidrosis

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412