GediPNet logo

TRAF1 (TNF receptor associated factor 1)
Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7185
Gene nameGene Name - the full gene name approved by the HGNC.
TNF receptor associated factor 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TRAF1
SynonymsGene synonyms aliases
EBI6, MGC:10353
ChromosomeChromosome number
9
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q33.2
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form
miRNAmiRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
miRTarBase ID miRNA Experiments Reference
MIRT027456 hsa-miR-98-5p Microarray 19088304
MIRT028837 hsa-miR-26b-5p Microarray 19088304
MIRT043860 hsa-miR-378a-3p CLASH 23622248
MIRT709882 hsa-miR-361-3p HITS-CLIP 19536157
MIRT709881 hsa-miR-6778-3p HITS-CLIP 19536157
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Transcription factor Regulation Reference
NFKB1 Activation 11297551;17018379;19343319;9733827
NFKB1 Unknown 10823821;14991743;17673602
NFKBIA Repression 9733827
RELA Activation 11297551;17018379;19343319;9733827
RELA Unknown 10823821;14991743;17673602
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0005164 Function Tumor necrosis factor receptor binding IBA 21873635
GO:0005164 Function Tumor necrosis factor receptor binding IPI 11728344
GO:0005515 Function Protein binding IPI 8069916, 9208847, 11279055, 11907583, 14743216, 20447407, 21516116, 21911467, 21988832, 23088713, 23524849, 25241761, 25416956, 26871637, 27107012, 28514442, 29892012, 30561431, 31515488, 32296183
GO:0005737 Component Cytoplasm TAS 8069916
GO:0005829 Component Cytosol TAS
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q13077
Protein name TNF receptor-associated factor 1 (Epstein-Barr virus-induced protein 6)
Protein function Adapter molecule that regulates the activation of NF-kappa-B and JNK. Plays a role in the regulation of cell survival and apoptosis. The heterotrimer formed by TRAF1 and TRAF2 is part of a E3 ubiquitin-protein ligase complex that promotes ubiqui
PDB 3M0D , 5E1T , 5H10
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16673 TRAF_BIRC3_bd
182 → 245
TNF receptor-associated factor BIRC3 binding domain
 Coiled-coil
Sequence 
MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGE
DLQSISPGSRLRTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
GFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQH
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQ
QTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK
YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST
Sequence length 416
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
 
KEGG
  
Reactome
  NF-kappa B signaling pathway
Apoptosis
TNF signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Small cell lung cancer 		  Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
Associated diseases
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Causal
Disease name Disease term dbSNP ID References
Autoimmune diseases Autoimmune Diseases rs41285370, rs869025224 21383967
Multiple sclerosis Multiple Sclerosis rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544 22190364
Patent ductus arteriosus Patent ductus arteriosus, Patent Ductus Arteriosus Familial rs80338911, rs879253870, rs879253871, rs879255278, rs879255279, rs879253872 19336370
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 17013881
Unknown
Disease name Disease term dbSNP ID References
Immune system diseases Immune System Diseases 21383967
Miscarriage Miscarriage 18539642
Prostatic neoplasms Prostatic Neoplasms 17013881

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412