GediPNet logo

TNFRSF1A (TNF receptor superfamily member 1A)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7132
Gene nameGene Name - the full gene name approved by the HGNC.
TNF receptor superfamily member 1A
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TNFRSF1A
SynonymsGene synonyms aliases
CD120a, FPF, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, p55, p55-R, p60
ChromosomeChromosome number
12
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.31
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the TNF receptor superfamily of proteins. The encoded receptor is found in membrane-bound and soluble forms that interact with membrane-bound and soluble forms, respectively, of its ligand, tumor necrosis factor alpha. Bindin
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1800693 T>C Benign, risk-factor, likely-benign Intron variant
rs4149584 C>G,T Conflicting-interpretations-of-pathogenicity, pathogenic Coding sequence variant, 5 prime UTR variant, missense variant, non coding transcript variant
rs34751757 G>A,T Not-provided, conflicting-interpretations-of-pathogenicity Non coding transcript variant, 5 prime UTR variant, coding sequence variant, missense variant
rs104895217 A>G Pathogenic Non coding transcript variant, 5 prime UTR variant, intron variant, coding sequence variant, missense variant
rs104895218 C>T Pathogenic Non coding transcript variant, 5 prime UTR variant, intron variant, coding sequence variant, missense variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051697 hsa-let-7e-5p CLASH 23622248
MIRT1443001 hsa-miR-1197 CLIP-seq
MIRT1443002 hsa-miR-1266 CLIP-seq
MIRT1443003 hsa-miR-194 CLIP-seq
MIRT1443004 hsa-miR-1973 CLIP-seq
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IDA 22801493
GO:0002947 Component Tumor necrosis factor receptor superfamily complex TAS 24966471
GO:0003176 Process Aortic valve development ISS
GO:0003177 Process Pulmonary valve development ISS
GO:0003332 Process Negative regulation of extracellular matrix constituent secretion ISS
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P19438
Protein name Tumor necrosis factor receptor superfamily member 1A (Tumor necrosis factor receptor 1) (TNF-R1) (Tumor necrosis factor receptor type I) (TNF-RI) (TNFR-I) (p55) (p60) (CD antigen CD120a) [Cleaved into: Tumor necrosis factor receptor superfamily member 1A,
Protein function Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation whic
PDB 1EXT , 1FT4 , 1ICH , 1NCF , 1TNR , 7K7A , 7KP7 , 7KP8 , 7KPB , 8P6Q
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6
44 81
TNFR/NGFR cysteine-rich region
Domain
PF00020 TNFR_c6
84 125
TNFR/NGFR cysteine-rich region
Domain
PF00020 TNFR_c6
127 166
TNFR/NGFR cysteine-rich region
Domain
PF00531 Death
356 441
Death domain
Domain
Sequence
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDC
RECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVC
GCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEAL
CGPAALPPAPSLLR
Sequence length 455
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  MAPK signaling pathway
Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
NF-kappa B signaling pathway
Sphingolipid signaling pathway
mTOR signaling pathway
Apoptosis
Apoptosis - multiple species
Necroptosis
Osteoclast differentiation
TNF signaling pathway
Adipocytokine signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease
Alcoholic liver disease
Alzheimer disease
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Chagas disease
Toxoplasmosis
Tuberculosis
Hepatitis C
Human cytomegalovirus infection
Influenza A
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis
  TNFR1-induced proapoptotic signaling
Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
TNFR1-mediated ceramide production
TNFs bind their physiological receptors
Interleukin-10 signaling
TNF signaling
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Amyloidosis Amyloidosis rs63750567, rs63750560, rs387906821, rs387906822, rs387906823, rs1561123748, rs140352180, rs770211260, rs763065333, rs1554300664, rs747723062, rs773435101
Arthritis Arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Autoimmune diseases Autoimmune Diseases rs41285370, rs869025224 21074606
Autoinflammatory disease Autoinflammatory disorder, Hereditary Autoinflammatory Diseases rs777759523, rs121434352, rs28940578, rs28940580, rs121908146, rs121908148, rs121908150, rs80338807, rs121908679, rs104895319, rs104894176, rs28933973, rs28933376, rs137854447, rs61736587, rs148755083, rs104895093, rs104895311, rs104895364, rs104895352, rs104895271, rs104895238, rs151344629, rs180177431, rs376785840, rs587777241, rs77563738, rs202134424, rs864321625, rs864321682, rs864321626, rs864321684, rs864321685, rs869312838, rs869312953, rs766657895, rs140148806, rs753966933, rs764196809, rs200956636, rs147035858, rs1274685768, rs1600700389, rs1776278098, rs754904956, rs1760720617, rs1760720924 17360963, 10199409
Unknown
Disease name Disease term dbSNP ID References
Ankylosing spondylitis Ankylosing spondylitis 23749187, 26974007
Anorexia Anorexia 18801959
Biliary cirrhosis Biliary cirrhosis, Biliary Cirrhosis, Primary, 1, Primary biliary cirrhosis 21399635, 28425483, 21399635, 26394269, 22961000
Cerebral ischemia Brain Ischemia 15829914

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412