TNFAIP6 (TNF alpha induced protein 6)

Gene

• Entrez ID: 7130
• Gene name: TNF alpha induced protein 6
• Gene symbol: TNFAIP6
• Synonyms: TSG-6, TSG6
• Chromosome: 2
• Chromosome location: 2q23.3
• Summary: The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and c

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT573255	hsa-miR-2052	PAR-CLIP	20371350
MIRT573256	hsa-miR-19a-5p	PAR-CLIP	20371350
MIRT573254	hsa-miR-19b-1-5p	PAR-CLIP	20371350
MIRT573253	hsa-miR-19b-2-5p	PAR-CLIP	20371350
MIRT573255	hsa-miR-2052	PAR-CLIP	20371350
MIRT573256	hsa-miR-19a-5p	PAR-CLIP	20371350
MIRT573254	hsa-miR-19b-1-5p	PAR-CLIP	20371350
MIRT573253	hsa-miR-19b-2-5p	PAR-CLIP	20371350
MIRT2647470	hsa-miR-137	CLIP-seq
MIRT2647471	hsa-miR-23a	CLIP-seq
MIRT2647472	hsa-miR-23b	CLIP-seq
MIRT2647473	hsa-miR-23c	CLIP-seq
MIRT2647474	hsa-miR-3160-5p	CLIP-seq
MIRT2647475	hsa-miR-337-3p	CLIP-seq
MIRT2647476	hsa-miR-3647-3p	CLIP-seq
MIRT2647477	hsa-miR-3685	CLIP-seq
MIRT2647478	hsa-miR-384	CLIP-seq
MIRT2647479	hsa-miR-3924	CLIP-seq
MIRT2647480	hsa-miR-4446-5p	CLIP-seq
MIRT2647481	hsa-miR-4517	CLIP-seq
MIRT2647482	hsa-miR-4654	CLIP-seq
MIRT2647483	hsa-miR-4712-3p	CLIP-seq
MIRT2647484	hsa-miR-4755-5p	CLIP-seq
MIRT2647485	hsa-miR-4769-5p	CLIP-seq
MIRT2647486	hsa-miR-561	CLIP-seq
MIRT2647487	hsa-miR-579	CLIP-seq
MIRT2647470	hsa-miR-137	CLIP-seq
MIRT2647471	hsa-miR-23a	CLIP-seq
MIRT2647472	hsa-miR-23b	CLIP-seq
MIRT2647473	hsa-miR-23c	CLIP-seq
MIRT2647474	hsa-miR-3160-5p	CLIP-seq
MIRT2647475	hsa-miR-337-3p	CLIP-seq
MIRT2647476	hsa-miR-3647-3p	CLIP-seq
MIRT2647477	hsa-miR-3685	CLIP-seq
MIRT2647478	hsa-miR-384	CLIP-seq
MIRT2647479	hsa-miR-3924	CLIP-seq
MIRT2647480	hsa-miR-4446-5p	CLIP-seq
MIRT2647481	hsa-miR-4517	CLIP-seq
MIRT2647482	hsa-miR-4654	CLIP-seq
MIRT2647483	hsa-miR-4712-3p	CLIP-seq
MIRT2647484	hsa-miR-4755-5p	CLIP-seq
MIRT2647485	hsa-miR-4769-5p	CLIP-seq
MIRT2647486	hsa-miR-561	CLIP-seq
MIRT2647487	hsa-miR-579	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPB	Activation	7876106
CEBPB	Unknown	7935377
CEBPD	Activation	23028973

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18042364, 18586671, 22267482, 24501198, 27044744
GO:0005540	Function	Hyaluronic acid binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006954	Process	Inflammatory response	TAS	1730767
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	TAS	1730767
GO:0007267	Process	Cell-cell signaling	TAS	1730767
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030728	Process	Ovulation	IEA
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0050728	Process	Negative regulation of inflammatory response	IBA	21873635
GO:0050728	Process	Negative regulation of inflammatory response	IDA	21569482
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 600410
• HGNC: 11898
• e!Ensembl: ENSG00000123610

Protein

• UniProt ID: P98066
• Protein name: Tumor necrosis factor-inducible gene 6 protein (EC 3.1.1.-) (Hyaluronate-binding protein) (TNF-stimulated gene 6 protein) (TSG-6) (Tumor necrosis factor alpha-induced protein 6) (TNF alpha-induced protein 6)
• Protein function: Major regulator of extracellular matrix organization during tissue remodeling (PubMed:15917224, PubMed:18042364, PubMed:26823460). Catalyzes the transfer of a heavy chain (HC) from inter-alpha-inhibitor (I-alpha-I) complex to hyaluronan. Cleaves
• PDB: 1O7B, 1O7C, 2N40, 2PF5, 2WNO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00193	Xlink	36 → 128	Extracellular link domain	Domain
  PF00431	CUB	135 → 244	CUB domain	Domain

• Sequence:

  MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEF
  EGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRS
  ERWDAYCYNPHAKECGGVFTDPKQIFKSPGFPNEYEDNQICYWHIRLKYGQRIHLSFLDF
  DLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGF
  QIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL

• Sequence length: 277

Pathways

Reactome:

Neutrophil degranulation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Dermatitis	Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	16033404, 17374397
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	31264924

Unknown
Disease name	Disease term	dbSNP ID	References
Arsenic encephalopathy	Arsenic Encephalopathy		16835338
Cerebral infraction	Infarction, Middle Cerebral Artery		12374626
Cerebral thrombosis	Middle Cerebral Artery Thrombosis		12374626
Dermatologic disorders	Dermatologic disorders		16835338
Diabetic maculopathy	Maculopathy with diabetes mellitus		31264924
Juvenile arthritis	Juvenile psoriatic arthritis		19565504
Seronegative polyarthritis	Polyarthritis, Juvenile, Rheumatoid Factor Negative		19565504
Polyarthritis, rheumatoid factor positive	Polyarthritis, Juvenile, Rheumatoid Factor Positive		19565504
Still disease	Juvenile-Onset Still Disease		19565504