GediPNet logo

TGIF1 (TGFB induced factor homeobox 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7050
Gene nameGene Name - the full gene name approved by the HGNC.
TGFB induced factor homeobox 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TGIF1
SynonymsGene synonyms aliases
HPE4, TGIF
ChromosomeChromosome number
18
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18p11.31
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously charact
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28939693 A>G,T Pathogenic, likely-benign Coding sequence variant, missense variant
rs121909066 C>G Pathogenic Missense variant, coding sequence variant
rs121909067 C>G Pathogenic Missense variant, coding sequence variant
rs121909068 A>C,G Pathogenic Missense variant, coding sequence variant
rs121909069 C>T Pathogenic Missense variant, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004287 hsa-miR-21-5p Western blot 19906824
MIRT641082 hsa-miR-186-5p HITS-CLIP 23824327
MIRT641081 hsa-miR-6507-5p HITS-CLIP 23824327
MIRT641080 hsa-miR-5003-3p HITS-CLIP 23824327
MIRT483883 hsa-miR-3613-3p HITS-CLIP 23824327
Transcription factors
Transcription factor Regulation Reference
HDAC4 Activation 17610967
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10764806
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 10764806
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q15583
Protein name Homeobox protein TGIF1 (5'-TG-3'-interacting factor 1)
Protein function Binds to a retinoid X receptor (RXR) responsive element from the cellular retinol-binding protein II promoter (CRBPII-RXRE). Inhibits the 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element. A
PDB 2LK2 , 6FQP , 6FQQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05920 Homeobox_KN
182 221
Homeobox KN domain
Family
Sequence
MVLAQSRVSAGVGSPHCSGSGGGGSDSFPWPASHPGNPQCSFSTAFLASPRLSRGTLAYL
PPAPWSSLATPSALLGSSCAPPPPPARCPQPRALSPELGTKAGPRRPHRWELPRSPSQGA
QGPAPRRRLLETMKGIVAASGSETEDEDSMDIPLDLSSSAGSGKRRRRGNLPKESVQILR
DWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTIS
RRGAKISETSSVESVMGIKNFMPALEETPFHSCTAGPNPTLGRPLSPKPSSPGSVLARPS
VICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSG
LFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA
Sequence length 401
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  TGF-beta signaling pathway   Downregulation of SMAD2/3:SMAD4 transcriptional activity
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Agenesis of corpus callosum Agenesis of corpus callosum rs754914260, rs1057519053, rs1057519056, rs1057519054, rs1057519055, rs1057519057, rs1384496494, rs1599017933
Asthma Asthma rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283
Hemangioma Hemangioma rs119475040, rs121917766
Holoprosencephaly Holoprosencephaly, HOLOPROSENCEPHALY 4 (disorder), HOLOPROSENCEPHALY 5 rs121917878, rs121917879, rs121917880, rs1572624159, rs137853021, rs397515364, rs397515365, rs2147483647, rs121909067, rs121909070, rs199476093, rs28936675, rs104894044, rs104894045, rs104894040, rs104894042, rs397515375, rs104894046, rs104894048, rs397515376, rs104894050, rs104894051, rs104894053, rs267607047, rs121917707, rs121917708, rs1594290658, rs387906867, rs387906995, rs387906996, rs387906997, rs398122882, rs397515499, rs397515500, rs397515502, rs587778786, rs587778788, rs587778789, rs587778792, rs146990376, rs587778799, rs587778803, rs587778805, rs587778806, rs794729641, rs864622212, rs876661335, rs876661331, rs876661330, rs876661329, rs886042458, rs1057518696, rs1057518689, rs1057518657, rs1057518660, rs763132615, rs1060499564, rs1060499563, rs1060499562, rs1554691658, rs1555332362, rs753473749, rs1554493810, rs1555332361, rs756225250, rs1554495331, rs528376963, rs1555650923, rs1554834892, rs139565972, rs1554834889, rs1490604080, rs1553337688, rs1554493607, rs1420292012, rs779093031, rs1555332212, rs1456001894, rs1558420022, rs1566405714, rs1567417422, rs1569507848, rs1584800601, rs1594291863, rs1584805934, rs1584806077, rs1594292057, rs1584800607, rs2053256914, rs1317614761, rs2057753419 16705179, 15221788, 11810641, 16962354, 23476075, 10835638
Unknown
Disease name Disease term dbSNP ID References
Alobar holoprosencephaly Alobar Holoprosencephaly 16705179
Ambiguous genitalia Ambiguous Genitalia rs782562963
Arrhinencephaly Arhinencephaly 16705179
Choanal atresia Choanal Atresia

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412