GediPNet logo

TRB (T cell receptor beta locus)
Gene
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6957
Gene nameGene Name - the full gene name approved by the HGNC.
T cell receptor beta locus
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TRB
SynonymsGene synonyms aliases
TCRB, TRB@
ChromosomeChromosome number
7
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q34
SummarySummary of gene provided in NCBI Entrez Gene.
T cell receptors recognize foreign antigens which have been processed as small peptides and bound to major histocompatibility complex (MHC) molecules at the surface of antigen presenting cells (APC). Each T cell receptor is a dimer consisting of one alpha
Transcription factors
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Transcription factor Regulation Reference
ETS1 Repression 1409722
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0002355 Process Detection of tumor cell IDA 31959982
GO:0002419 Process T cell mediated cytotoxicity directed against tumor cell target IDA 31959982
GO:0016021 Component Integral component of membrane IEA
GO:0038023 Function Signaling receptor activity IDA 31959982
GO:0042105 Component Alpha-beta T cell receptor complex IDA 31959982
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID P0DSE2
Protein name M1-specific T cell receptor beta chain (TR beta chain TRBV19*01J2S7*01C*02)
Protein function The beta chain of TRAV27*01J42*01C*01/TRBV19*01J2S7*01C*02 alpha-beta T cell receptor (TR) clonotype that is specific for HLA-A*02:01-restricted M/matrix protein 1 immunodominant epitope GILGFVFTL of influenza A virus (IAV). Classified as a publ
PDB 1OGA , 2VLJ , 2VLK , 2VLR , 5HHM , 5HHO , 6JXR , 7FJD , 7FJE , 7FJF
UniProt ID P0DTU4
Protein name T cell receptor beta chain MC.7.G5 (TR beta chain TRBV25-1*01J2S3*01C2*01) (MC.7.G5 TRB)
Protein function The beta chain of TRAV38-2DV8*01J31*01C*01/TRBV25-1*01J2S3*01C2*01 alpha-beta T cell receptor (TR) clonotype that displays pan-cancer cell recognition via the invariant MR1 molecule. On CD8-positive T cell clone MC.7.G5, likely recognizes tumor-
PDB 8T4Z , 8TW4 , 8Y6X , 8YIV , 8YJ2 , 8YJ3 , 9C3E
Family and domains
Sequence 
MTIRLLCYMGFYFLGAGLMEADIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGM
ELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSEARGLAE
FTDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELS
WWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLS
ENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVS
ALVLMAMVKRKDSRG
Sequence length 315
Interactions View interactions
Associated diseases
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Causal
Disease name Disease term dbSNP ID References
Lymphoblastic leukemia Precursor T-Cell Lymphoblastic Leukemia-Lymphoma, Precursor T-cell acute lymphoblastic leukemia rs387906351, rs104894562, rs398122513, rs398122840, rs398123063, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412