GediPNet logo

TRA (T cell receptor alpha locus)
Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6955
Gene nameGene Name - the full gene name approved by the HGNC.
T cell receptor alpha locus
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TRA
SynonymsGene synonyms aliases
IMD7, TCRA, TRA@
ChromosomeChromosome number
14
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q11.2
miRNAmiRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
miRTarBase ID miRNA Experiments Reference
MIRT737032 hsa-miR-193a-3p Luciferase reporter assay, Western blotting, Flow cytometry 34288281
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Transcription factor Regulation Reference
ETS1 Activation 1535773
ETS1 Unknown 2237431
GATA3 Unknown 11385613
POU2F1 Unknown 11385613
POU2F2 Unknown 11385613
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0002355 Process Detection of tumor cell IDA 31959982
GO:0002419 Process T cell mediated cytotoxicity directed against tumor cell target IDA 31959982
GO:0016021 Component Integral component of membrane IEA
GO:0038023 Function Signaling receptor activity IDA 31959982
GO:0042105 Component Alpha-beta T cell receptor complex IDA 31959982
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID P0DSE1
Protein name M1-specific T cell receptor alpha chain (TR alpha chain TRAV27*01J42*01C*01)
Protein function The alpha chain of TRAV27*01J42*01C*01/TRBV19*01J2S7*01C*02 alpha-beta T cell receptor (TR) clonotype that is specific for HLA-A*02:01-restricted M/matrix protein 1 immunodominant epitope GILGFVFTL of influenza A virus (IAV). Classified as a pub
PDB 1OGA , 2VLJ , 2VLK , 2VLR , 5HHM , 5HHO
UniProt ID P0DTU3
Protein name T cell receptor alpha chain MC.7.G5 (MC.7.G5 TRA) (TR alpha chain TRAV38-2DV8*01J31*01C*01)
Protein function The alpha chain of TRAV38-2DV8*01J31*01C*01/TRBV25-1*01J2S3*01C2*01 alpha-beta T cell receptor (TR) clonotype that displays pan-cancer cell recognition via the invariant MR1 molecule. On CD8-positive T cell clone MC.7.G5, likely recognizes tumor
Family and domains
Sequence 
MACPGFLWALVISTCLEFSMAQTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQP
PSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRSAVNA
RLMFGDGTQLVVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITD
KTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFET
DTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS
Sequence length 275
Interactions View interactions
Associated diseases
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Causal
Disease name Disease term dbSNP ID References
Lymphoblastic leukemia Precursor T-Cell Lymphoblastic Leukemia-Lymphoma, Precursor T-cell acute lymphoblastic leukemia rs387906351, rs104894562, rs398122513, rs398122840, rs398123063, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591 29279377
Narcolepsy Narcolepsy rs104894574, rs387906655 19412176
Unknown
Disease name Disease term dbSNP ID References
Narcolepsy-cataplexy syndrome Narcolepsy-Cataplexy Syndrome 19412176

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412