TCF21 (transcription factor 21)

Gene

• Entrez ID: 6943
• Gene name: Transcription factor 21
• Gene symbol: TCF21
• Synonyms: POD1, bHLHa23
• Chromosome: 6
• Chromosome location: 6q23.2
• Summary: TCF21 encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006075	hsa-miR-492	Microarray, qRT-PCR	21319197
MIRT007085	hsa-miR-21-5p	Luciferase reporter assay	23206776
MIRT025053	hsa-miR-181a-5p	Microarray	17612493
MIRT492081	hsa-miR-6735-3p	PAR-CLIP	23592263
MIRT492082	hsa-miR-4721	PAR-CLIP	23592263
MIRT492083	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT492084	hsa-miR-7107-5p	PAR-CLIP	23592263
MIRT492085	hsa-miR-1234-3p	PAR-CLIP	23592263
MIRT492086	hsa-miR-5088-5p	PAR-CLIP	23592263

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12493738
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	12493738
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001657	Process	Ureteric bud development	ISS
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	ISS
GO:0001763	Process	Morphogenesis of a branching structure	ISS
GO:0001822	Process	Kidney development	ISS
GO:0001944	Process	Vasculature development	ISS
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005634	Component	Nucleus	IDA	12493738
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007530	Process	Sex determination	ISS
GO:0014707	Process	Branchiomeric skeletal muscle development	ISS
GO:0030855	Process	Epithelial cell differentiation	ISS
GO:0032502	Process	Developmental process	IBA	21873635
GO:0032835	Process	Glomerulus development	ISS
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043425	Function	BHLH transcription factor binding	IPI	12493738
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046983	Function	Protein dimerization activity	ISS
GO:0048286	Process	Lung alveolus development	ISS
GO:0048536	Process	Spleen development	ISS
GO:0048557	Process	Embryonic digestive tract morphogenesis	ISS
GO:0048608	Process	Reproductive structure development	ISS
GO:0048732	Process	Gland development	ISS
GO:0050681	Function	Androgen receptor binding	ISS
GO:0060008	Process	Sertoli cell differentiation	ISS
GO:0060021	Process	Roof of mouth development	ISS
GO:0060425	Process	Lung morphogenesis	ISS
GO:0060426	Process	Lung vasculature development	ISS
GO:0060435	Process	Bronchiole development	ISS
GO:0060539	Process	Diaphragm development	ISS
GO:0060541	Process	Respiratory system development	ISS
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	ISS
GO:0070888	Function	E-box binding	ISS
GO:0072162	Process	Metanephric mesenchymal cell differentiation	ISS
GO:0072277	Process	Metanephric glomerular capillary formation	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 603306
• HGNC: 11632
• e!Ensembl: ENSG00000118526

Protein

• UniProt ID: O43680
• Protein name: Transcription factor 21 (TCF-21) (Capsulin) (Class A basic helix-loop-helix protein 23) (bHLHa23) (Epicardin) (Podocyte-expressed 1) (Pod-1)
• Protein function: Involved in epithelial-mesenchymal interactions in kidney and lung morphogenesis that include epithelial differentiation and branching morphogenesis. May play a role in the specification or differentiation of one or more subsets of epicardial cell types.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	80 → 132	Helix-loop-helix DNA-binding domain	Domain

• Sequence:

  MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRR
  KAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDT
  LRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS

• Sequence length: 179

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Coronary artery disease	CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT, 1, Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	23202125, 24262325, 21378990, 22751097
Coronary heart disease	Coronary heart disease	rs-1	21378990, 24262325

Unknown
Disease name	Disease term	dbSNP ID	References
Coronary arteriosclerosis	Coronary Arteriosclerosis		21378990, 22751097
Stroke	Cerebrovascular accident		24262325