GediPNet logo

TCF21 (transcription factor 21)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6943
Gene nameGene Name - the full gene name approved by the HGNC.
Transcription factor 21
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TCF21
SynonymsGene synonyms aliases
POD1, bHLHa23
ChromosomeChromosome number
6
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q23.2
SummarySummary of gene provided in NCBI Entrez Gene.
TCF21 encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006075 hsa-miR-492 Microarray, qRT-PCR 21319197
MIRT006075 hsa-miR-492 Microarray, qRT-PCR 21319197
MIRT006075 hsa-miR-492 Microarray, qRT-PCR 21319197
MIRT007085 hsa-miR-21-5p Luciferase reporter assay 23206776
MIRT007085 hsa-miR-21-5p Luciferase reporter assay 23206776
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 12493738
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID O43680
Protein name Transcription factor 21 (TCF-21) (Capsulin) (Class A basic helix-loop-helix protein 23) (bHLHa23) (Epicardin) (Podocyte-expressed 1) (Pod-1)
Protein function Involved in epithelial-mesenchymal interactions in kidney and lung morphogenesis that include epithelial differentiation and branching morphogenesis. May play a role in the specification or differentiation of one or more subsets of epicardial ce
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH
80 132
Helix-loop-helix DNA-binding domain
Domain
Sequence
MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRR
KAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDT
LRLASSYIAHLR
QILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS
Sequence length 179
Interactions View interactions
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Coronary artery disease CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT, 1, Coronary Artery Disease rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537 23202125, 24262325, 21378990, 23202125, 22751097
Unknown
Disease name Disease term dbSNP ID References
Coronary arteriosclerosis Coronary Arteriosclerosis 21378990, 22751097
Coronary heart disease Coronary heart disease rs9289231, rs281864746 21378990, 24262325
Stroke Cerebrovascular accident 24262325

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412