GediPNet logo

TBX5 (T-box transcription factor 5)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6910
Gene nameGene Name - the full gene name approved by the HGNC.
T-box transcription factor 5
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TBX5
SynonymsGene synonyms aliases
HOS
ChromosomeChromosome number
12
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.21
SummarySummary of gene provided in NCBI Entrez Gene.
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104894377 C>A Pathogenic Coding sequence variant, stop gained
rs104894378 C>G,T Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs104894379 G>A,C,T Pathogenic Coding sequence variant, stop gained, synonymous variant
rs104894381 C>T Pathogenic Coding sequence variant, missense variant
rs104894382 G>A Pathogenic Coding sequence variant, missense variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018791 hsa-miR-335-5p Microarray 18185580
MIRT1415302 hsa-miR-2355-3p CLIP-seq
MIRT1415303 hsa-miR-3119 CLIP-seq
MIRT1415304 hsa-miR-342-3p CLIP-seq
MIRT1415305 hsa-miR-4639-3p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
NKX2-5 Unknown 15095414
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 26926761
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IDA 29174768
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q99593
Protein name T-box transcription factor TBX5 (T-box protein 5)
Protein function DNA-binding protein that regulates the transcription of several genes and is involved in heart development and limb pattern formation (PubMed:25725155, PubMed:25963046, PubMed:26917986, PubMed:27035640, PubMed:29174768, PubMed:8988164). Binds to
PDB 2X6U , 2X6V , 4S0H , 5BQD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00907 T-box
56 238
T-box
Domain
Sequence
MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHE
RELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNK
WSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQ
PRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRG
SD
DMELHRMSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGP
SQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSSYPQ
QQGLGASYRTESAQRQACMYASSAPPSEPVPSLEDISCNTWPSMPSYSSCTVTTVQPMDR
LPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPG
TLQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS
Sequence length 518
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    YAP1- and WWTR1 (TAZ)-stimulated gene expression
Physiological factors
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Aortic valve disease AORTIC VALVE DISEASE 2 rs104894378, rs104894382, rs387907283, rs863223788, rs863223786, rs863223777, rs878853750, rs886041247, rs1057516042, rs1057520136, rs863223776, rs1555226420, rs1060503154, rs1555225344, rs1555225989, rs1555226005, rs1555226322, rs764038221, rs1565941046, rs1565927747, rs1565923835, rs1565941072, rs1595804976, rs1593847163, rs1593883930, rs1593881162, rs1870762150, rs1871328960, rs1871673161, rs1208004863, rs1872004016, rs1871328488, rs1871673582 16917909, 10077612, 11555635, 12499378, 8988164, 16183809, 20519243, 21637475, 8988165, 10077762, 17534187, 25500235, 12789647, 15710732, 25931334, 16380715
Atrial fibrillation Atrial Fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557, rs587777558, rs587777559, rs587777560, rs886037778, rs769405762, rs770372675 29892015, 28416822, 28416818, 30061737, 22544366
Atrial septal defect Atrial Septal Defects, ATRIAL SEPTAL DEFECT 1 rs137852951, rs137852953, rs137852955, rs267607106, rs104893900, rs104893901, rs104893903, rs606231358, rs606231359, rs137852683, rs606231360, rs104893907, rs104894073, rs1585703301, rs104894074, rs267606903, rs121912677, rs387906585, rs387906773, rs72554028, rs587782928, rs587782929, rs587782930, rs587784067, rs1555226315, rs879253754, rs1114167356, rs773922431, rs1554093487, rs1554093433, rs1554093461, rs1561621507, rs1561619801, rs766692577, rs1581108237, rs1581111034, rs1579663872, rs1583066622, rs1456289029, rs1761430125
Atrioventricular block First degree atrioventricular block rs766840243, rs763809932
Unknown
Disease name Disease term dbSNP ID References
Clinodactyly Clinodactyly of fingers
Short clavicles Congenital hypoplasia of clavicle
Congenital pectus excavatum Congenital pectus excavatum
Paroxysmal atrial fibrillation Paroxysmal atrial fibrillation rs199865688, rs397515994, rs757096307 30061737, 29892015

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412