GediPNet logo

TAL2 (TAL bHLH transcription factor 2)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6887
Gene nameGene Name - the full gene name approved by the HGNC.
TAL bHLH transcription factor 2
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TAL2
SynonymsGene synonyms aliases
-
ChromosomeChromosome number
9
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q31.2
SummarySummary of gene provided in NCBI Entrez Gene.
This intronless gene encodes a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-c
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT723276 hsa-miR-1237-3p HITS-CLIP 19536157
MIRT723275 hsa-miR-1248 HITS-CLIP 19536157
MIRT723274 hsa-miR-130b-5p HITS-CLIP 19536157
MIRT723273 hsa-miR-3124-3p HITS-CLIP 19536157
MIRT723272 hsa-miR-627-3p HITS-CLIP 19536157
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding TAS 1763056
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q16559
Protein name T-cell acute lymphocytic leukemia protein 2 (TAL-2) (Class A basic helix-loop-helix protein 19) (bHLHa19)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH
3 55
Helix-loop-helix DNA-binding domain
Domain
Sequence
MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGE
QSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP
Sequence length 108
Interactions View interactions
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Lymphoblastic leukemia Childhood Acute Lymphoblastic Leukemia, L2 Acute Lymphoblastic Leukemia, Precursor Cell Lymphoblastic Leukemia Lymphoma rs387906351, rs104894562, rs398122513, rs398122840, rs398123063, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412