TAC1 (tachykinin precursor 1)

Gene

• Entrez ID: 6863
• Gene name: Tachykinin precursor 1
• Gene symbol: TAC1
• Synonyms: Hs.2563, NK2, NKNA, NPK, TAC2
• Chromosome: 7
• Chromosome location: 7q21.3
• Summary: This gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and neuropeptide gamma. These hormones are thought to function as neurotransmitters which interact with

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003005	hsa-miR-130a-3p	Luciferase reporter assay	17855557
MIRT003004	hsa-miR-206	Luciferase reporter assay	17855557
MIRT003003	hsa-miR-320a	Luciferase reporter assay	17855557
MIRT020344	hsa-miR-302a-3p	Reporter assay	17855557
MIRT003004	hsa-miR-206	Reporter assay;Other	17855557
MIRT003005	hsa-miR-130a-3p	Reporter assay;Other	17855557

Transcription factors

Transcription factor	Regulation	Reference
REST	Repression	12220737;19246391

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002675	Process	Positive regulation of acute inflammatory response	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005886	Component	Plasma membrane	IEA
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	8957234
GO:0007217	Process	Tachykinin receptor signaling pathway	IBA	21873635
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	1708336
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007320	Process	Insemination	TAS	1708336
GO:0007616	Process	Long-term memory	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008306	Process	Associative learning	IEA
GO:0009582	Process	Detection of abiotic stimulus	TAS	9482938
GO:0009725	Process	Response to hormone	IEA
GO:0010459	Process	Negative regulation of heart rate	IEA
GO:0010634	Process	Positive regulation of epithelial cell migration	IEA
GO:0019233	Process	Sensory perception of pain	IEA
GO:0030424	Component	Axon	IEA
GO:0031835	Function	Substance P receptor binding	IBA	21873635
GO:0032224	Process	Positive regulation of synaptic transmission, cholinergic	IEA
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0035815	Process	Positive regulation of renal sodium excretion	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043278	Process	Response to morphine	IEA
GO:0045202	Component	Synapse	IEA
GO:0045760	Process	Positive regulation of action potential	IEA
GO:0045778	Process	Positive regulation of ossification	IEA
GO:0046878	Process	Positive regulation of saliva secretion	IEA
GO:0048265	Process	Response to pain	IEA
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IEA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:2000854	Process	Positive regulation of corticosterone secretion	IEA

Other IDs

• MIM: 162320
• HGNC: 11517
• e!Ensembl: ENSG00000006128

Protein

• UniProt ID: P20366
• Protein name: Protachykinin-1 (PPT) [Cleaved into: Substance P; Neurokinin A (NKA) (Neuromedin L) (Substance K); Neuropeptide K (NPK); Neuropeptide gamma; C-terminal-flanking peptide]
• Protein function: Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.
• PDB: 2B19, 2KS9, 2KSA, 2KSB, 4HOM, 7P00, 7P02, 7RMG, 7RMH, 7VDM, 7XWO, 8JBH, 8U26
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02202	Tachykinin	58 → 68	Tachykinin family	Family

• Sequence:

  MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPK
  PQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERS
  AMQNYERRR

• Sequence length: 129

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Tachykinin receptors bind tachykinins
G alpha (q) signalling events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Narcolepsy	Narcolepsy	rs104894574, rs387906655	17521418
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	15845098

Unknown
Disease name	Disease term	dbSNP ID	References
Amnesia	Amnesia		9521815, 20600432, 7562510
Anorexia	Anorexia		30336258
Bipolar disorder	Bipolar Disorder, Depression, Bipolar		15845098
Bronchial hyperreactivity	Bronchial Hyperreactivity		16777450
Cirrhosis	Cirrhosis	rs119465999, rs144369314, rs8056684, rs112053857, rs75998507	28647476
Common migraine	Common Migraine		11304026
Corneal diseases	Corneal Diseases		12824234
Gastroesophageal reflux disease	Gastroesophageal reflux disease		20616304
Hyperemia	Hyperemia		10564113, 7507874
Involutional depression	Involutional Depression		15845098
Involutional paraphrenia	Involutional paraphrenia		15845098
Manic disorder	Manic, Manic Disorder		15845098
Mental depression	Mental Depression, Depressive disorder, Major Depressive Disorder	rs587778876, rs587778877	21912391, 24705689, 16594257, 17477887, 22155476, 17477887, 22155476, 16594257, 24705689, 21912391, 15845098
Mood disorder	Mood Disorders		22225676, 16806114, 12562138, 15927090, 15845098
Narcolepsy-cataplexy syndrome	Narcolepsy-Cataplexy Syndrome		17521418
Psychosis	Psychosis, Involutional		15845098