AURKC (aurora kinase C)

Gene

• Entrez ID: 6795
• Gene name: Aurora kinase C
• Gene symbol: AURKC
• Synonyms: AIE2, AIK3, ARK3, AurC, HEL-S-90, SPGF5, STK13, aurora-C
• Chromosome: 19
• Chromosome location: 19q13.43
• Summary: This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs74179426	->C	Conflicting-interpretations-of-pathogenicity	5 prime UTR variant, non coding transcript variant, intron variant
rs121908654	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs397515484	A>G	Pathogenic	Splice acceptor variant
rs397515619	C>-	Pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT812205	hsa-miR-125a-5p	CLIP-seq
MIRT812206	hsa-miR-125b	CLIP-seq
MIRT812207	hsa-miR-4319	CLIP-seq
MIRT812208	hsa-miR-4732-3p	CLIP-seq
MIRT812209	hsa-miR-4768-3p	CLIP-seq
MIRT812210	hsa-miR-665	CLIP-seq
MIRT812211	hsa-miR-670	CLIP-seq
MIRT812205	hsa-miR-125a-5p	CLIP-seq
MIRT812206	hsa-miR-125b	CLIP-seq
MIRT812207	hsa-miR-4319	CLIP-seq
MIRT812208	hsa-miR-4732-3p	CLIP-seq
MIRT812211	hsa-miR-670	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000793	Component	Condensed chromosome	IDA	15670791
GO:0004672	Function	Protein kinase activity	IDA	15670791
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	TAS	19774610
GO:0005515	Function	Protein binding	IPI	21988832, 27332895, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	TAS	19774610
GO:0005876	Component	Spindle microtubule	IBA	21873635
GO:0006468	Process	Protein phosphorylation	IDA	15670791
GO:0007052	Process	Mitotic spindle organization	IBA	21873635
GO:0007283	Process	Spermatogenesis	IEA
GO:0008608	Process	Attachment of spindle microtubules to kinetochore	TAS	19774610
GO:0016570	Process	Histone modification	TAS	19774610
GO:0030496	Component	Midbody	IDA	15670791
GO:0030496	Component	Midbody	TAS	19774610
GO:0031616	Component	Spindle pole centrosome	IBA	21873635
GO:0032133	Component	Chromosome passenger complex	IBA	21873635
GO:0032133	Component	Chromosome passenger complex	TAS	19774610
GO:0032465	Process	Regulation of cytokinesis	IBA	21873635
GO:0032467	Process	Positive regulation of cytokinesis	TAS	19774610
GO:0035174	Function	Histone serine kinase activity	IBA	21873635
GO:0035404	Process	Histone-serine phosphorylation	IEA
GO:0048599	Process	Oocyte development	IEA
GO:0051233	Component	Spindle midzone	IBA	21873635
GO:0051233	Component	Spindle midzone	IDA	15670791
GO:0051256	Process	Mitotic spindle midzone assembly	TAS	19774610
GO:0051301	Process	Cell division	IEA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA

Other IDs

• MIM: 603495
• HGNC: 11391
• e!Ensembl: ENSG00000105146

Protein

• UniProt ID: Q9UQB9
• Protein name: Aurora kinase C (EC 2.7.11.1) (Aurora 3) (Aurora/IPL1-related kinase 3) (ARK-3) (Aurora-related kinase 3) (Aurora/IPL1/Eg2 protein 2) (Serine/threonine-protein kinase 13) (Serine/threonine-protein kinase aurora-C)
• Protein function: Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segre
• PDB: 6GR8, 6GR9, 9ESA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	43 → 293	Protein kinase domain	Domain

• Sequence:

  MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLA
  RLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLIL
  EYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEV
  KIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFE
  SASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRV
  LPPCAQMAS

• Sequence length: 309

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Infertility associated with multi-tailed spermatozoa and excessive dna	Male Infertility with Large-Headed, Multiflagellar, Polyploid Spermatozoa	rs397515619, rs121908654, rs397515484	21733974, 17435757
Lung carcinoma	Squamous cell carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370, rs760043106, rs1057519788, rs1131692238, rs1131692237, rs1554350382
Male infertility	Male infertility due to large-headed multiflagellar polyploid spermatozoa	rs554675432, rs9332971, rs397507505, rs797045116, rs748618094, rs781431741, rs1555979575, rs377581367