SSTR5 (somatostatin receptor 5)

Gene

• Entrez ID: 6755
• Gene name: Somatostatin receptor 5
• Gene symbol: SSTR5
• Synonyms: SS-5-R, SST5
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: Somatostatin and its related peptide cortistatin exert multiple biological actions on normal and tumoral tissue targets by interacting with somatostatin receptors (SSTRs). The protein encoded by this gene is one of the SSTRs, which is a multi-pass membran

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1392875	hsa-let-7a	CLIP-seq
MIRT1392876	hsa-let-7b	CLIP-seq
MIRT1392877	hsa-let-7c	CLIP-seq
MIRT1392878	hsa-let-7d	CLIP-seq
MIRT1392879	hsa-let-7e	CLIP-seq
MIRT1392880	hsa-let-7f	CLIP-seq
MIRT1392881	hsa-let-7g	CLIP-seq
MIRT1392882	hsa-let-7i	CLIP-seq
MIRT1392883	hsa-miR-1197	CLIP-seq
MIRT1392884	hsa-miR-125a-5p	CLIP-seq
MIRT1392885	hsa-miR-125b	CLIP-seq
MIRT1392886	hsa-miR-1275	CLIP-seq
MIRT1392887	hsa-miR-2467-3p	CLIP-seq
MIRT1392888	hsa-miR-3170	CLIP-seq
MIRT1392889	hsa-miR-342-5p	CLIP-seq
MIRT1392890	hsa-miR-4260	CLIP-seq
MIRT1392891	hsa-miR-4319	CLIP-seq
MIRT1392892	hsa-miR-4447	CLIP-seq
MIRT1392893	hsa-miR-4458	CLIP-seq
MIRT1392894	hsa-miR-4472	CLIP-seq
MIRT1392895	hsa-miR-4500	CLIP-seq
MIRT1392896	hsa-miR-4525	CLIP-seq
MIRT1392897	hsa-miR-4649-3p	CLIP-seq
MIRT1392898	hsa-miR-4651	CLIP-seq
MIRT1392899	hsa-miR-4664-5p	CLIP-seq
MIRT1392900	hsa-miR-4665-5p	CLIP-seq
MIRT1392901	hsa-miR-4723-5p	CLIP-seq
MIRT1392902	hsa-miR-4732-3p	CLIP-seq
MIRT1392903	hsa-miR-544b	CLIP-seq
MIRT1392904	hsa-miR-608	CLIP-seq
MIRT1392905	hsa-miR-615-5p	CLIP-seq
MIRT1392906	hsa-miR-625	CLIP-seq
MIRT1392907	hsa-miR-670	CLIP-seq
MIRT1392908	hsa-miR-98	CLIP-seq
MIRT2117917	hsa-miR-1285	CLIP-seq
MIRT2117918	hsa-miR-3187-5p	CLIP-seq
MIRT2117919	hsa-miR-378g	CLIP-seq
MIRT2117920	hsa-miR-4486	CLIP-seq
MIRT2117921	hsa-miR-612	CLIP-seq
MIRT2339888	hsa-miR-1291	CLIP-seq
MIRT2339889	hsa-miR-214	CLIP-seq
MIRT2339890	hsa-miR-3144-5p	CLIP-seq
MIRT2339891	hsa-miR-3619-5p	CLIP-seq
MIRT2339892	hsa-miR-4435	CLIP-seq
MIRT2339893	hsa-miR-761	CLIP-seq
MIRT2460575	hsa-miR-3183	CLIP-seq
MIRT2460576	hsa-miR-3197	CLIP-seq
MIRT2460577	hsa-miR-339-5p	CLIP-seq
MIRT2460578	hsa-miR-3909	CLIP-seq
MIRT2460579	hsa-miR-4316	CLIP-seq
MIRT2460580	hsa-miR-4534	CLIP-seq
MIRT2460581	hsa-miR-4640-5p	CLIP-seq
MIRT2460582	hsa-miR-4710	CLIP-seq
MIRT2460583	hsa-miR-4723-3p	CLIP-seq
MIRT2460584	hsa-miR-4725-5p	CLIP-seq
MIRT2460585	hsa-miR-4726-5p	CLIP-seq
MIRT1392902	hsa-miR-4732-3p	CLIP-seq
MIRT2460586	hsa-miR-4802-5p	CLIP-seq
MIRT2460587	hsa-miR-504	CLIP-seq
MIRT2460588	hsa-miR-515-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004994	Function	Somatostatin receptor activity	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	7908405
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9892014
GO:0032467	Process	Positive regulation of cytokinesis	IMP	22888021
GO:0038170	Process	Somatostatin signaling pathway	IEA
GO:0042277	Function	Peptide binding	IBA	21873635
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042923	Function	Neuropeptide binding	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0050796	Process	Regulation of insulin secretion	IBA	21873635
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IBA	21873635

Other IDs

• MIM: 182455
• HGNC: 11334
• e!Ensembl: ENSG00000162009

Protein

• UniProt ID: P35346
• Protein name: Somatostatin receptor type 5 (SS-5-R) (SS5-R) (SS5R) (SST5)
• Protein function: Receptor for somatostatin 28 and to a lesser extent for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. Increases cell growth inhibition activity of SSTR2 following heterodimerization. {EC
• PDB: 8X8L, 8X8N, 8ZBE, 8ZCJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	57 → 304	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL
  VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG
  VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV
  QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR
  RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN
  PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ
  TSKL

• Sequence length: 364

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Growth hormone synthesis, secretion and action

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		12192619, 20398908
Grand mal status epilepticus	Grand Mal Status Epilepticus		18951627
Mental depression	Unipolar Depression, Major Depressive Disorder	rs587778876, rs587778877	20398908
Nonconvulsive status epilepticus	Non-Convulsive Status Epilepticus		18951627
Petit mal status	Petit mal status		18951627
Status epilepticus	Status Epilepticus, Complex Partial Status Epilepticus, Status Epilepticus, Subclinical		18951627